Lineage for d2ebna_ (2ebn A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829818Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2831708Family c.1.8.5: Type II chitinase [51534] (15 proteins)
    glycosylase family 18
  6. 2831857Protein Endo-beta-N-acetylglucosaminidase [51540] (3 species)
  7. 2831858Species Flavobacterium meningosepticum, endoglycosidase F1 [TaxId:238] [51541] (1 PDB entry)
  8. 2831859Domain d2ebna_: 2ebn A: [28990]
    complexed with zn

Details for d2ebna_

PDB Entry: 2ebn (more details), 2 Å

PDB Description: crystal structure of endo-beta-n-acetylglucosaminidase f1, an alpha(slash)beta-barrel enzyme adapted for a complex substrate
PDB Compounds: (A:) endo-beta-n-acetylglucosaminidase f1

SCOPe Domain Sequences for d2ebna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ebna_ c.1.8.5 (A:) Endo-beta-N-acetylglucosaminidase {Flavobacterium meningosepticum, endoglycosidase F1 [TaxId: 238]}
ttkaniklfsftevndtnplnnlnftlknsgkplvdmvvlfsaninydaandkvfvsnnp
nvqhlltnrakylkplqdkgikvilsilgnhdrsgianlstarakafaqelkntcdlynl
dgvffddeysayqtpppsgfvtpsnnaaarlayetkqampnklvtvyvysrtssfptavd
gvnagsyvdyaihdyggsydlatnypglaksgmvmssqefnqgryataqalrnivtkgyg
ghmifamdpnrsnftsgqlpalkliakelygdelvysntpyskdw

SCOPe Domain Coordinates for d2ebna_:

Click to download the PDB-style file with coordinates for d2ebna_.
(The format of our PDB-style files is described here.)

Timeline for d2ebna_: