Lineage for d1cnv__ (1cnv -)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 18353Fold c.1: TIM beta/alpha-barrel [51350] (23 superfamilies)
  4. 18710Superfamily c.1.8: (Trans)glycosidases [51445] (7 families) (S)
  5. 19083Family c.1.8.5: Type II chitinase [51534] (6 proteins)
  6. 19118Protein Seed storage protein [51537] (2 species)
  7. 19119Species Jack bean (Canavalia ensiformis), Concanavalin B [TaxId:3823] [51539] (1 PDB entry)
  8. 19120Domain d1cnv__: 1cnv - [28989]

Details for d1cnv__

PDB Entry: 1cnv (more details), 1.65 Å

PDB Description: crystal structure of concanavalin b at 1.65 a resolution

SCOP Domain Sequences for d1cnv__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cnv__ c.1.8.5 (-) Seed storage protein {Jack bean (Canavalia ensiformis), Concanavalin B}
dissteiavywgqredgllrdtcktnnykivfisfldkfgceirkpelelegvcgpsvgn
pcsflesqikecqrmgvkvflalggpkgtysacsadyakdlaeylhtyflserregplgk
valdgihfdiqkpvdelnwdnlleelyqikdvyqstfllsaapgclspdeyldnaiqtrh
fdyifvrfyndrscqystgniqrirnawlswtksvyprdknlflelpasqatapgggyip
psaligqvlpylpdlqtryagialwnrqadketgystniiryl

SCOP Domain Coordinates for d1cnv__:

Click to download the PDB-style file with coordinates for d1cnv__.
(The format of our PDB-style files is described here.)

Timeline for d1cnv__: