Lineage for d1nar__ (1nar -)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 18353Fold c.1: TIM beta/alpha-barrel [51350] (23 superfamilies)
  4. 18710Superfamily c.1.8: (Trans)glycosidases [51445] (7 families) (S)
  5. 19083Family c.1.8.5: Type II chitinase [51534] (6 proteins)
  6. 19118Protein Seed storage protein [51537] (2 species)
  7. 19121Species Vicia narbonensis, Narbonin [TaxId:3912] [51538] (1 PDB entry)
  8. 19122Domain d1nar__: 1nar - [28988]

Details for d1nar__

PDB Entry: 1nar (more details), 1.8 Å

PDB Description: crystal structure of narbonin refined at 1.8 angstroms resolution

SCOP Domain Sequences for d1nar__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nar__ c.1.8.5 (-) Seed storage protein {Vicia narbonensis, Narbonin}
pkpifreyigvkpnsttlhdfpteiintetlefhyilgfaiesyyesgkgtgtfeeswdv
elfgpekvknlkrrhpevkvvisiggrgvntpfdpaeenvwvsnakeslkliiqkysdds
gnlidgidihyehirsdepfatlmgqlitelkkdddlninvvsiapsennsshyqklyna
kkdyinwvdyqfsnqqkpvstddafveifkslekdyhphkvlpgfstdpldtkhnkitrd
ifiggctrlvqtfslpgvffwnandsvipkrdgdkpfiveltlqqllaa

SCOP Domain Coordinates for d1nar__:

Click to download the PDB-style file with coordinates for d1nar__.
(The format of our PDB-style files is described here.)

Timeline for d1nar__: