Lineage for d2hvm__ (2hvm -)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 64292Fold c.1: TIM beta/alpha-barrel [51350] (24 superfamilies)
  4. 64720Superfamily c.1.8: (Trans)glycosidases [51445] (8 families) (S)
  5. 65132Family c.1.8.5: Type II chitinase [51534] (7 proteins)
  6. 65174Protein Hevamine A (chitinase/lysozyme) [51535] (1 species)
  7. 65175Species Para rubber tree (Hevea brasiliensis) [TaxId:3981] [51536] (3 PDB entries)
  8. 65176Domain d2hvm__: 2hvm - [28985]

Details for d2hvm__

PDB Entry: 2hvm (more details), 1.8 Å

PDB Description: hevamine a at 1.8 angstrom resolution

SCOP Domain Sequences for d2hvm__:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hvm__ c.1.8.5 (-) Hevamine A (chitinase/lysozyme) {Para rubber tree (Hevea brasiliensis)}
ggiaiywgqngnegtltqtcstrkysyvniaflnkfgngqtpqinlaghcnpaaggctiv
sngirscqiqgikvmlslgggigsytlasqadaknvadylwnnflggksssrplgdavld
gidfdiehgstlywddlarylsayskqgkkvyltaapqcpfpdrylgtalntglfdyvwv
qfynnppcqyssgninniinswnrwttsinagkiflglpaapeaagsgyvppdvlisril
peikkspkyggvmlwskfyddkngysssildsv

SCOP Domain Coordinates for d2hvm__:

Click to download the PDB-style file with coordinates for d2hvm__.
(The format of our PDB-style files is described here.)

Timeline for d2hvm__: