Lineage for d1fh8a_ (1fh8 A:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 968086Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 969862Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 970330Family c.1.8.3: beta-glycanases [51487] (27 proteins)
    consist of a number of sequence families
  6. 970766Protein Xylanase A, catalytic core [51514] (8 species)
  7. 970767Species Cellulomonas fimi [TaxId:1708] [51520] (14 PDB entries)
    synonym: beta-1,4-glycanase Cex
  8. 970777Domain d1fh8a_: 1fh8 A: [28916]

Details for d1fh8a_

PDB Entry: 1fh8 (more details), 1.95 Å

PDB Description: crystal structure of the xylanase cex with xylobiose-derived isofagomine inhibitor
PDB Compounds: (A:) beta-1,4-xylanase

SCOPe Domain Sequences for d1fh8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fh8a_ c.1.8.3 (A:) Xylanase A, catalytic core {Cellulomonas fimi [TaxId: 1708]}
attlkeaadgagrdfgfaldpnrlseaqykaiadsefnlvvaenamkwdatepsqnsfsf
gagdrvasyaadtgkelyghtlvwhsqlpdwaknlngsafesamvnhvtkvadhfegkva
swdvvneafadgggrrqdsafqqklgngyietafraaraadptaklcindynveginaks
nslydlvkdfkargvpldcvgfqshlivgqvpgdfrqnlqrfadlgvdvriteldirmrt
psdatklatqaadykkvvqacmqvtrcqgvtvwgitdkyswvpdvfpgegaalvwdasya
kkpayaavmeaf

SCOPe Domain Coordinates for d1fh8a_:

Click to download the PDB-style file with coordinates for d1fh8a_.
(The format of our PDB-style files is described here.)

Timeline for d1fh8a_: