Lineage for d1fh9a_ (1fh9 A:)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 115904Fold c.1: TIM beta/alpha-barrel [51350] (24 superfamilies)
  4. 116348Superfamily c.1.8: (Trans)glycosidases [51445] (9 families) (S)
  5. 116528Family c.1.8.3: beta-glycanases [51487] (13 proteins)
  6. 116733Protein Xylanase A, catalytic core [51514] (6 species)
  7. 116734Species Cellulomonas fimi [TaxId:1708] [51520] (8 PDB entries)
  8. 116735Domain d1fh9a_: 1fh9 A: [28913]

Details for d1fh9a_

PDB Entry: 1fh9 (more details), 1.72 Å

PDB Description: crystal structure of the xylanase cex with xylobiose-derived lactam oxime inhibitor

SCOP Domain Sequences for d1fh9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fh9a_ c.1.8.3 (A:) Xylanase A, catalytic core {Cellulomonas fimi}
attlkeaadgagrdfgfaldpnrlseaqykaiadsefnlvvaenamkwdatepsqnsfsf
gagdrvasyaadtgkelyghtlvwhsqlpdwaknlngsafesamvnhvtkvadhfegkva
swdvvneafadgggrrqdsafqqklgngyietafraaraadptaklcindynveginaks
nslydlvkdfkargvpldcvgfqshlivgqvpgdfrqnlqrfadlgvdvriteldirmrt
psdatklatqaadykkvvqacmqvtrcqgvtvwgitdkyswvpdvfpgegaalvwdasya
kkpayaavmeaf

SCOP Domain Coordinates for d1fh9a_:

Click to download the PDB-style file with coordinates for d1fh9a_.
(The format of our PDB-style files is described here.)

Timeline for d1fh9a_: