Lineage for d1tixa_ (1tix A:)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 64292Fold c.1: TIM beta/alpha-barrel [51350] (24 superfamilies)
  4. 64720Superfamily c.1.8: (Trans)glycosidases [51445] (8 families) (S)
  5. 64889Family c.1.8.3: beta-glycanases [51487] (14 proteins)
  6. 65011Protein Xylanase A, catalytic core [51514] (6 species)
  7. 65046Species Thermoascus aurantiacus [TaxId:5087] [51518] (4 PDB entries)
  8. 65050Domain d1tixa_: 1tix A: [28908]

Details for d1tixa_

PDB Entry: 1tix (more details), 1.92 Å

PDB Description: thermostable xylanase i from thermoascus aurantiacus

SCOP Domain Sequences for d1tixa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tixa_ c.1.8.3 (A:) Xylanase A, catalytic core {Thermoascus aurantiacus}
asaqsvdqlikargkvyfgvatdqnrlttgknaaiiqadfgqvtpensmkwdatepsqgn
fnfagadylvnwaqqngklirghtlvwhsqlpswvtsitdkntltnvmknhittlmtryk
gkirawdvvneafnqngslrstvflnvigedyipiafqtaraadpnaklyindynldsat
ypktqaivnrvkqwraagvpidgigsqthlsagqgagvlnalpllasagtpevaiteldv
agasptdyvnvvnaclnvsscvgitvwgvadpdswrasttpllfdgnfnpkpaynaivqn
lq

SCOP Domain Coordinates for d1tixa_:

Click to download the PDB-style file with coordinates for d1tixa_.
(The format of our PDB-style files is described here.)

Timeline for d1tixa_: