SCOPe 2.01: Domain d1tuxa_: 1tux A:

Lineage for d1tuxa_ (1tux A:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.3: beta-glycanases [51487] (27 proteins)
   consist of a number of sequence families

6. Protein Xylanase A, catalytic core [51514] (8 species)

7. Species Thermoascus aurantiacus [TaxId:5087] [51518] (10 PDB entries)

8. Domain d1tuxa_: 1tux A: [28907]
   X-ray determined sequence differs from that in other entries

Details for d1tuxa_

PDB Entry: 1tux, 1.8 Å

PDB Description: high resolution crystal structure of a thermostable xylanase from thermoascus aurantiacus

PDB Compounds: (A:) xylanase

SCOPe Domain Sequences for d1tuxa_:

Sequence; same for both SEQRES and ATOM records:

>d1tuxa_ c.1.8.3 (A:) Xylanase A, catalytic core {Thermoascus aurantiacus [TaxId: 5087]}
aaaqsvdqlidargkvyfgvatdqnrlttgknaaiiqadfgqvtpensmkwdatepsqgn
fnfagadylvnwaqqngklirghtlvwhsqlpswvvsitdkntltnvmknhittimtryi
gkirawdvvneafnedgslrqtvfnnvigedyipiafrtaraadpnaklyindynldsas
kpktsaivkrvkkwraagvpidgigsqthlsagqgasidaalpnlasagtpevaiteldi
agatstdyvdvvnacldvdscigitvwgvadpdswrasttpllfdgnfnpkpaynaivql
l

Timeline for d1tuxa_:

• d1tuxa_ first appeared (with stable ids) in SCOP 1.55, called d1tux__
  
• d1tuxa_ appears in SCOP 1.75
  
• d1tuxa_ appears in SCOPe 2.02
  
• d1tuxa_ appears in the current release, SCOPe 2.08