Lineage for d1taxa_ (1tax A:)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 115904Fold c.1: TIM beta/alpha-barrel [51350] (24 superfamilies)
  4. 116348Superfamily c.1.8: (Trans)glycosidases [51445] (9 families) (S)
  5. 116528Family c.1.8.3: beta-glycanases [51487] (13 proteins)
  6. 116733Protein Xylanase A, catalytic core [51514] (6 species)
  7. 116780Species Thermoascus aurantiacus [TaxId:5087] [51518] (9 PDB entries)
  8. 116783Domain d1taxa_: 1tax A: [28906]

Details for d1taxa_

PDB Entry: 1tax (more details), 1.14 Å

PDB Description: thermostable xylanase i from thermoascus aurantiacus

SCOP Domain Sequences for d1taxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1taxa_ c.1.8.3 (A:) Xylanase A, catalytic core {Thermoascus aurantiacus}
asaqsvdqlikargkvyfgvatdqnrlttgknaaiiqanfgqvtpensmkwdatepsqgn
fnfagadylvnwaqqngklirghtlvwhsqlpswvtsitdkntltnvmknhittlmtryk
gkirawdvvneafnqngslrstvflnvigedyipiafqtaraadpnaklyindynldsat
ypktqaivnrvkqwraagvpidgigsqthlsagqgagvlnalpllasagtpevaiteldv
agasptdyvnvvnaclnvsscvgitvwgvadpdswrasttpllfdgnfnpkpaynaivqn
lq

SCOP Domain Coordinates for d1taxa_:

Click to download the PDB-style file with coordinates for d1taxa_.
(The format of our PDB-style files is described here.)

Timeline for d1taxa_: