Lineage for d1bhga3 (1bhg A:329-632)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1143364Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1145288Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 1145755Family c.1.8.3: beta-glycanases [51487] (27 proteins)
    consist of a number of sequence families
  6. 1145980Protein beta-Glucuronidase, domain 3 [51512] (1 species)
  7. 1145981Species Human (Homo sapiens) [TaxId:9606] [51513] (1 PDB entry)
  8. 1145982Domain d1bhga3: 1bhg A:329-632 [28889]
    Other proteins in same PDB: d1bhga1, d1bhga2, d1bhgb1, d1bhgb2

Details for d1bhga3

PDB Entry: 1bhg (more details), 2.53 Å

PDB Description: human beta-glucuronidase at 2.6 a resolution
PDB Compounds: (A:) beta-glucuronidase

SCOPe Domain Sequences for d1bhga3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bhga3 c.1.8.3 (A:329-632) beta-Glucuronidase, domain 3 {Human (Homo sapiens) [TaxId: 9606]}
vavtksqflingkpfyfhgvnkhedadirgkgfdwpllvkdfnllrwlganafrtshypy
aeevmqmcdrygivvidecpgvglalpqffnnvslhhhmqvmeevvrrdknhpavvmwsv
anepashlesagyylkmviahtksldpsrpvtfvsnsnyaadkgapyvdviclnsyyswy
hdyghleliqlqlatqfenwykkyqkpiiqseygaetiagfhqdpplmfteeyqkslleq
yhlgldqkrrkyvvgeliwnfadfmteqsptrvlgnkkgiftrqrqpksaafllrerywk
iane

SCOPe Domain Coordinates for d1bhga3:

Click to download the PDB-style file with coordinates for d1bhga3.
(The format of our PDB-style files is described here.)

Timeline for d1bhga3: