Lineage for d1f4hd5 (1f4h D:334-625)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829818Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2830557Family c.1.8.3: beta-glycanases [51487] (27 proteins)
    consist of a number of sequence families
  6. 2830645Protein beta-Galactosidase, domain 3 [51510] (3 species)
  7. 2830653Species Escherichia coli [TaxId:562] [51511] (46 PDB entries)
    Uniprot P00722
  8. 2830865Domain d1f4hd5: 1f4h D:334-625 [28888]
    Other proteins in same PDB: d1f4ha1, d1f4ha2, d1f4ha3, d1f4ha4, d1f4hb1, d1f4hb2, d1f4hb3, d1f4hb4, d1f4hc1, d1f4hc2, d1f4hc3, d1f4hc4, d1f4hd1, d1f4hd2, d1f4hd3, d1f4hd4
    complexed with mg

Details for d1f4hd5

PDB Entry: 1f4h (more details), 2.8 Å

PDB Description: e. coli (lacz) beta-galactosidase (orthorhombic)
PDB Compounds: (D:) beta-galactosidase

SCOPe Domain Sequences for d1f4hd5:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f4hd5 c.1.8.3 (D:334-625) beta-Galactosidase, domain 3 {Escherichia coli [TaxId: 562]}
evriengllllngkpllirgvnrhehhplhgqvmdeqtmvqdillmkqnnfnavrcshyp
nhplwytlcdryglyvvdeaniethgmvpmnrltddprwlpamservtrmvqrdrnhpsv
iiwslgnesghganhdalyrwiksvdpsrpvqyegggadttatdiicpmyarvdedqpfp
avpkwsikkwlslpgetrplilceyahamgnslggfakywqafrqyprlqggfvwdwvdq
slikydengnpwsayggdfgdtpndrqfcmnglvfadrtphpalteakhqqq

SCOPe Domain Coordinates for d1f4hd5:

Click to download the PDB-style file with coordinates for d1f4hd5.
(The format of our PDB-style files is described here.)

Timeline for d1f4hd5: