Lineage for d1bgmp5 (1bgm P:334-625)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1143364Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1145288Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 1145755Family c.1.8.3: beta-glycanases [51487] (27 proteins)
    consist of a number of sequence families
  6. 1145839Protein beta-Galactosidase, domain 3 [51510] (2 species)
  7. 1145847Species Escherichia coli [TaxId:562] [51511] (25 PDB entries)
    Uniprot P00722
  8. 1145935Domain d1bgmp5: 1bgm P:334-625 [28856]
    Other proteins in same PDB: d1bgmi1, d1bgmi2, d1bgmi3, d1bgmi4, d1bgmj1, d1bgmj2, d1bgmj3, d1bgmj4, d1bgmk1, d1bgmk2, d1bgmk3, d1bgmk4, d1bgml1, d1bgml2, d1bgml3, d1bgml4, d1bgmm1, d1bgmm2, d1bgmm3, d1bgmm4, d1bgmn1, d1bgmn2, d1bgmn3, d1bgmn4, d1bgmo1, d1bgmo2, d1bgmo3, d1bgmo4, d1bgmp1, d1bgmp2, d1bgmp3, d1bgmp4
    complexed with mg

Details for d1bgmp5

PDB Entry: 1bgm (more details), 2.5 Å

PDB Description: beta-galactosidase (chains i-p)
PDB Compounds: (P:) beta-galactosidase

SCOPe Domain Sequences for d1bgmp5:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bgmp5 c.1.8.3 (P:334-625) beta-Galactosidase, domain 3 {Escherichia coli [TaxId: 562]}
evriengllllngkpllirgvnrhehhplhgqvmdeqtmvqdillmkqnnfnavrcshyp
nhplwytlcdryglyvvdeaniethgmvpmnrltddprwlpamservtrmvqrdrnhpsv
iiwslgnesghganhdalyrwiksvdpsrpvqyegggadttatdiicpmyarvdedqpfp
avpkwsikkwlslpgetrplilceyahamgnslggfakywqafrqyprlqggfvwdwvdq
slikydengnpwsayggdfgdtpndrqfcmnglvfadrtphpalteakhqqq

SCOPe Domain Coordinates for d1bgmp5:

Click to download the PDB-style file with coordinates for d1bgmp5.
(The format of our PDB-style files is described here.)

Timeline for d1bgmp5: