Lineage for d5bcac2 (5bca C:1-417)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 18353Fold c.1: TIM beta/alpha-barrel [51350] (23 superfamilies)
  4. 18710Superfamily c.1.8: (Trans)glycosidases [51445] (7 families) (S)
  5. 18834Family c.1.8.2: beta-Amylase [51480] (2 proteins)
  6. 18835Protein Bacterial beta-amylase, catalytic domain [51485] (1 species)
  7. 18836Species Bacillus cereus [TaxId:1396] [51486] (3 PDB entries)
  8. 18840Domain d5bcac2: 5bca C:1-417 [28801]
    Other proteins in same PDB: d5bcaa1, d5bcab1, d5bcac1, d5bcad1

Details for d5bcac2

PDB Entry: 5bca (more details), 2.2 Å

PDB Description: beta-amylase from bacillus cereus var. mycoides

SCOP Domain Sequences for d5bcac2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5bcac2 c.1.8.2 (C:1-417) Bacterial beta-amylase, catalytic domain {Bacillus cereus}
avngkgmnpdykaylmaplkkipevtnwetfendlrwakqngfyaitvdfwwgdmekngd
qqfdfsyaqrfaqsvknagmkmipiisthqcggnvgddcnvpipswvwnqksddslyfks
etgtvnketlnplasdvirkeygelytafaaamkpykdviakiylsggpagelrypsytt
sdgtgypsrgkfqaytefakskfrlwvlnkygslnevnkawgtkliselailppsdgeqf
lmngylsmygkdylewyqgilenhtkligelahnafdttfqvpigakiagvhwqynnpti
phgaekpagyndyshlldafksakldvtftclemtdkgsypeysmpktlvqniatlanek
givlngenalsigneeeykrvaemafnynfagftllryqdvmynnslmgkfkdllgv

SCOP Domain Coordinates for d5bcac2:

Click to download the PDB-style file with coordinates for d5bcac2.
(The format of our PDB-style files is described here.)

Timeline for d5bcac2: