SCOP 1.63: Domain d1byd__: 1byd -

Lineage for d1byd__ (1byd -)

1. Root: SCOP 1.63

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (26 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (9 families)

5. Family c.1.8.1: Amylase, catalytic domain [51446] (21 proteins)
   members of the family may contain various insert subdomains
   in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain

6. Protein beta-Amylase [51481] (3 species)
   Common fold covers whole protein structure

7. Species Soybean (Glycine max) [TaxId:3847] [51482] (6 PDB entries)

8. Domain d1byd__: 1byd - [28794]
   complexed with dom, so4

Details for d1byd__

PDB Entry: 1byd, 2.2 Å

PDB Description: crystal structures of soybean beta-amylase reacted with beta-maltose and maltal: active site components and their apparent role in catalysis

SCOP Domain Sequences for d1byd__:

Sequence; same for both SEQRES and ATOM records:

>d1byd__ c.1.8.1 (-) beta-Amylase {Soybean (Glycine max)}
snmllnyvpvyvmlplgvvnvdnvfedpdglkeqllqlraagvdgvmvdvwwgiielkgp
kqydwrayrslfqlvqecgltlqaimsfhqcggnvgdivnipipqwvldigesnhdifyt
nrsgtrnkeyltvgvdnepifhgrtaieiysdymksfrenmsdflesgliidievglgpa
gelrypsypqsqgwefprigefqcydkylkadfkaavaraghpewelpddagkyndvpes
tgffksngtyvtekgkffltwysnkllnhgdqildeankaflgckvklaikvsgihwwyk
venhaaeltagyynlndrdgyrpiarmlsrhhailnftclemrdseqpsdaksgpqelvq
qvlsggwredirvagenalprydataynqiilnakpqgvnnngppklsmfgvtylrlsdd
llqksnfnifkkfvlkmhadqdycanpqkynhaitplkpsapkipievlleatkptlpfp
wlpetdmkvdg

Timeline for d1byd__:

• d1byd__ first appeared (with stable ids) in SCOP 1.55
  
• d1byd__ appears in SCOP 1.61
  
• d1byd__ appears in SCOP 1.65
  
• d1byd__ appears in the current release, SCOPe 2.08, called d1byda_