Lineage for d1bfn__ (1bfn -)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 64292Fold c.1: TIM beta/alpha-barrel [51350] (24 superfamilies)
  4. 64720Superfamily c.1.8: (Trans)glycosidases [51445] (8 families) (S)
  5. 64868Family c.1.8.2: beta-Amylase [51480] (2 proteins)
  6. 64877Protein beta-Amylase [51481] (3 species)
  7. 64880Species Soybean (Glycine max) [TaxId:3847] [51482] (6 PDB entries)
  8. 64882Domain d1bfn__: 1bfn - [28792]

Details for d1bfn__

PDB Entry: 1bfn (more details), 2.07 Å

PDB Description: beta-amylase/beta-cyclodextrin complex

SCOP Domain Sequences for d1bfn__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bfn__ c.1.8.2 (-) beta-Amylase {Soybean (Glycine max)}
nmllnyvpvyvmlplgvvnvdnvfedpdglkeqllqlraagvdgvmvdvwwgiielkgpk
qydwrayrsllqlvqecgltlqaimsfhqcggnvgdivnipipqwvldigesnhdifytn
rsgtrnkeyltvgvdnepifhgrtaieiysdymksfrenmsdflesgliidievglgpag
elrypsypqsqgwefpgigefqcydkylkadfkaavaraghpewelpddagkyndvpest
gffksngtyvtekgkffltwysnkllnhgdqildeankaflgckvklaikvsgihwwykv
enhaaeltagyynlndrdgyrpiarmlsrhhailnftclemrdseqpsdaksgpqelvqq
vlsggwredirvagenalprydataynqiilnarpqgvnnngppklsmfgvtylrlsddl
lqksnfnifkkfvlkmhadqdycanpqkynhaitplkpsapkipievlleatkptlpfpw
lpetdmkvdg

SCOP Domain Coordinates for d1bfn__:

Click to download the PDB-style file with coordinates for d1bfn__.
(The format of our PDB-style files is described here.)

Timeline for d1bfn__: