Lineage for d1btc__ (1btc -)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 64292Fold c.1: TIM beta/alpha-barrel [51350] (24 superfamilies)
  4. 64720Superfamily c.1.8: (Trans)glycosidases [51445] (8 families) (S)
  5. 64868Family c.1.8.2: beta-Amylase [51480] (2 proteins)
  6. 64877Protein beta-Amylase [51481] (3 species)
  7. 64880Species Soybean (Glycine max) [TaxId:3847] [51482] (6 PDB entries)
  8. 64883Domain d1btc__: 1btc - [28791]

Details for d1btc__

PDB Entry: 1btc (more details), 2 Å

PDB Description: three-dimensional structure of soybean beta-amylase determined at 3.0 angstroms resolution: preliminary chain tracing of the complex with alpha-cyclodextrin

SCOP Domain Sequences for d1btc__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1btc__ c.1.8.2 (-) beta-Amylase {Soybean (Glycine max)}
snmllnyvpvyvmlplgvvnvdnvfedpdglkeqllqlraagvdgvmvdvwwgiielkgp
kqydwrayrslfqlvqecgltlqaimsfhqcggnvgdivnipipqwvldigesnhdifyt
nrsgtrnkeyltvgvdnepifhgrtaieiysdymksfrenmsdflesgliidievglgpa
gelrypsypqsqgwefprigefqcydkylkadfkaavaraghpewelpddagkyndvpes
tgffksngtyvtekgkffltwysnkllnhgdqildeankaflgckvklaikvsgihwwyk
venhaaeltagyynlndrdgyrpiarmlsrhhailnftclemrdseqpsdaksgpqelvq
qvlsggwredirvagenalprydataynqiilnakpqgvnnngppklsmfgvtylrlsdd
llqksnfnifkkfvlkmhadqdycanpqkynhaitplkpsapkipievlleatkptlpfp
wlpetdmkvdg

SCOP Domain Coordinates for d1btc__:

Click to download the PDB-style file with coordinates for d1btc__.
(The format of our PDB-style files is described here.)

Timeline for d1btc__: