Lineage for d1uoka2 (1uok A:1-479)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829818Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2829819Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins)
    members of the family may contain various insert subdomains
    in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain
  6. 2830312Protein Oligo-1,6, glucosidase [51476] (1 species)
  7. 2830313Species Bacillus cereus [TaxId:1396] [51477] (1 PDB entry)
  8. 2830314Domain d1uoka2: 1uok A:1-479 [28788]
    Other proteins in same PDB: d1uoka1

Details for d1uoka2

PDB Entry: 1uok (more details), 2 Å

PDB Description: crystal structure of b. cereus oligo-1,6-glucosidase
PDB Compounds: (A:) oligo-1,6-glucosidase

SCOPe Domain Sequences for d1uoka2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uoka2 c.1.8.1 (A:1-479) Oligo-1,6, glucosidase {Bacillus cereus [TaxId: 1396]}
mekqwwkesvvyqiyprsfmdsngdgigdlrgiiskldylkelgidviwlspvyespndd
ngydisdyckimnefgtmedwdellhemhernmklmmdlvvnhtsdehnwfiesrkskdn
kyrdyyiwrpgkegkepnnwgaafsgsawqydemtdeyylhlfskkqpdlnwdnekvrqd
vyemmkfwlekgidgfrmdvinfiskeeglptveteeegyvsghkhfmngpnihkylhem
neevlshydimtvgempgvtteeaklytgeerkelqmvfqfehmdldsgeggkwdvkpcs
lltlkenltkwqkalehtgwnslywnnhdqprvvsrfgndgmyriesakmlatvlhmmkg
tpyiyqgeeigmtnvrfesideyrdietlnmykekvmergediekvmqsiyikgrdnart
pmqwddqnhagfttgepwitvnpnykeinvkqaiqnkdsifyyykklielrknneivvy

SCOPe Domain Coordinates for d1uoka2:

Click to download the PDB-style file with coordinates for d1uoka2.
(The format of our PDB-style files is described here.)

Timeline for d1uoka2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1uoka1