Lineage for d1amya2 (1amy A:1-346)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1815292Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1818156Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 1818157Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins)
    members of the family may contain various insert subdomains
    in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain
  6. 1818617Protein Plant alpha-amylase [51474] (2 species)
  7. 1818628Species Barley (Hordeum vulgare), seeds, AMY2 isozyme [TaxId:4513] [51475] (3 PDB entries)
  8. 1818632Domain d1amya2: 1amy A:1-346 [28786]
    Other proteins in same PDB: d1amya1
    complexed with ca

Details for d1amya2

PDB Entry: 1amy (more details), 2.8 Å

PDB Description: crystal and molecular structure of barley alpha-amylase
PDB Compounds: (A:) 1,4-alpha-d-glucan glucanohydrolase

SCOPe Domain Sequences for d1amya2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1amya2 c.1.8.1 (A:1-346) Plant alpha-amylase {Barley (Hordeum vulgare), seeds, AMY2 isozyme [TaxId: 4513]}
qvlfqgfnweswkhnggwynflmgkvddiaaagithvwlppasqsvaeqgympgrlydld
askygnkaqlksligalhgkgvkaiadivinhrtaehkdgrgiycifeggtpdarldwgp
hmicrddrpyadgtgnpdtgadfgaapdidhlnlrvqkelvewlnwlkadigfdgwrfdf
akgysadvakiyidrsepsfavaeiwtslayggdgkpnlnqdqhrqelvnwvdkvggkgp
attfdfttkgilnvavegelwrlrgtdgkapgmigwwpakavtfvdnhdtgstqhmwpfp
sdrvmqgyayilthpgtpcifydhffdwglkeeidrlvsvrtrhgi

SCOPe Domain Coordinates for d1amya2:

Click to download the PDB-style file with coordinates for d1amya2.
(The format of our PDB-style files is described here.)

Timeline for d1amya2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1amya1