SCOPe 2.03: Domain d1ehaa3: 1eha A:91-490

Lineage for d1ehaa3 (1eha A:91-490)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins)
   members of the family may contain various insert subdomains
   in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain

6. Protein Glycosyltrehalose trehalohydrolase, central domain [51468] (2 species)
   contains an additional N-terminal domain

7. Species Sulfolobus solfataricus, km1 [TaxId:2287] [51469] (3 PDB entries)

8. Domain d1ehaa3: 1eha A:91-490 [28773]
   Other proteins in same PDB: d1ehaa1, d1ehaa2

Details for d1ehaa3

PDB Entry: 1eha, 3 Å

PDB Description: crystal structure of glycosyltrehalose trehalohydrolase from sulfolobus solfataricus

PDB Compounds: (A:) glycosyltrehalose trehalohydrolase

SCOPe Domain Sequences for d1ehaa3:

Sequence; same for both SEQRES and ATOM records:

>d1ehaa3 c.1.8.1 (A:91-490) Glycosyltrehalose trehalohydrolase, central domain {Sulfolobus solfataricus, km1 [TaxId: 2287]}
fnnetflkkedliiyeihvgtftpegtfegvirkldylkdlgitaieimpiaqfpgkrdw
gydgvylyavqnsyggpegfrklvdeahkkglgvildvvynhvgpegnymvklgpyfsqk
yktpwgltfnfddaesdevrkfilenveywikeynvdgfrldavhaiidtspkhileeia
dvvhkynriviaesdlndprvvnpkekvgynidaqwvddfhhsihayltgerqgyytdfg
nlddivksykdvfvydgkysnfrrkthgepvgeldgcnfvvyiqnhdqvgnrgkgeriik
lvdresykiaaalyllspyipmifmgeeygeenpfyffsdfsdskliqgvregrkkengq
dtdpqdestfnasklswkideeifsfykilikmrkelsia

Timeline for d1ehaa3:

• d1ehaa3 first appeared (with stable ids) in SCOP 1.55
  
• d1ehaa3 appears in SCOPe 2.02
  
• d1ehaa3 appears in SCOPe 2.04
  
• d1ehaa3 appears in the current release, SCOPe 2.08