Lineage for d6taaa2 (6taa A:1-381)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1565956Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1568602Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 1568603Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins)
    members of the family may contain various insert subdomains
    in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain
  6. 1568897Protein Fungal alpha-amylases [51462] (2 species)
  7. 1568900Species Aspergillus oryzae, Taka-amylase [TaxId:5062] [51464] (8 PDB entries)
  8. 1568907Domain d6taaa2: 6taa A:1-381 [28766]
    Other proteins in same PDB: d6taaa1
    complexed with ca

Details for d6taaa2

PDB Entry: 6taa (more details), 2.1 Å

PDB Description: structure and molecular model refinement of aspergillus oryzae (taka) alpha-amylase: an application of the simulated-annealing method
PDB Compounds: (A:) alpha-amylase

SCOPe Domain Sequences for d6taaa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6taaa2 c.1.8.1 (A:1-381) Fungal alpha-amylases {Aspergillus oryzae, Taka-amylase [TaxId: 5062]}
atpadwrsqsiyflltdrfartdgsttatcntadqkycggtwqgiidkldyiqgmgftai
witpvtaqlpqttaygdayhgywqqdiyslnenygtaddlkalssalhergmylmvdvva
nhmgydgagssvdysvfkpfssqdyfhpfcfiqnyedqtqvedcwlgdntvslpdldttk
dvvknewydwvgslvsnysidglridtvkhvqkdfwpgynkaagvycigevldgdpaytc
pyqnvmdgvlnypiyypllnafkstsgsmddlynmintvksdcpdstllgtfvenhdnpr
fasytndialaknvaafiilndgipiiyagqeqhyaggndpanreatwlsgyptdselyk
liasanairnyaiskdtgfvt

SCOPe Domain Coordinates for d6taaa2:

Click to download the PDB-style file with coordinates for d6taaa2.
(The format of our PDB-style files is described here.)

Timeline for d6taaa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d6taaa1