Lineage for d2hldu2 (2hld U:97-376)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2869423Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (22 proteins)
    core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest
  6. 2869484Protein Central domain of alpha subunit of F1 ATP synthase [88774] (5 species)
  7. 2869487Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [310928] (2 PDB entries)
  8. 2869496Domain d2hldu2: 2hld U:97-376 [287617]
    Other proteins in same PDB: d2hld1_, d2hlda1, d2hlda3, d2hldb1, d2hldb3, d2hldc1, d2hldc3, d2hldd1, d2hldd2, d2hldd3, d2hlde1, d2hlde2, d2hlde3, d2hldf1, d2hldf2, d2hldf3, d2hldg_, d2hldh1, d2hldh2, d2hldi_, d2hldj1, d2hldj3, d2hldk1, d2hldk3, d2hldl1, d2hldl3, d2hldm1, d2hldm2, d2hldm3, d2hldn1, d2hldn2, d2hldn3, d2hldo1, d2hldo2, d2hldo3, d2hldp_, d2hldq1, d2hldq2, d2hldr_, d2hlds1, d2hlds3, d2hldt1, d2hldt3, d2hldu1, d2hldu3, d2hldv1, d2hldv2, d2hldv3, d2hldw1, d2hldw2, d2hldw3, d2hldx1, d2hldx2, d2hldx3, d2hldy_, d2hldz1
    complexed with anp, mg, po4

Details for d2hldu2

PDB Entry: 2hld (more details), 2.8 Å

PDB Description: Crystal structure of yeast mitochondrial F1-ATPase
PDB Compounds: (U:) ATP synthase alpha chain, mitochondrial

SCOPe Domain Sequences for d2hldu2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hldu2 c.37.1.11 (U:97-376) Central domain of alpha subunit of F1 ATP synthase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
vdvpvgpgllgrvvdalgnpidgkgpidaagrsraqvkapgilprrsvhepvqtglkavd
alvpigrgqreliigdrqtgktavaldtilnqkrwnngsdeskklycvyvavgqkrstva
qlvqtleqhdamkysiivaataseaaplqylapftaasigewfrdngkhalivyddlskq
avayrqlslllrrppgreaypgdvfylhsrlleraaklsekegsgsltalpvietqggdv
sayiptnvisitdgqifleaelfykgirpainvglsvsrv

SCOPe Domain Coordinates for d2hldu2:

Click to download the PDB-style file with coordinates for d2hldu2.
(The format of our PDB-style files is described here.)

Timeline for d2hldu2:

View in 3D
Domains from other chains:
(mouse over for more information)
d2hld1_, d2hlda1, d2hlda2, d2hlda3, d2hldb1, d2hldb2, d2hldb3, d2hldc1, d2hldc2, d2hldc3, d2hldd1, d2hldd2, d2hldd3, d2hlde1, d2hlde2, d2hlde3, d2hldf1, d2hldf2, d2hldf3, d2hldg_, d2hldh1, d2hldh2, d2hldi_, d2hldj1, d2hldj2, d2hldj3, d2hldk1, d2hldk2, d2hldk3, d2hldl1, d2hldl2, d2hldl3, d2hldm1, d2hldm2, d2hldm3, d2hldn1, d2hldn2, d2hldn3, d2hldo1, d2hldo2, d2hldo3, d2hldp_, d2hldq1, d2hldq2, d2hldr_, d2hlds1, d2hlds2, d2hlds3, d2hldt1, d2hldt2, d2hldt3, d2hldv1, d2hldv2, d2hldv3, d2hldw1, d2hldw2, d2hldw3, d2hldx1, d2hldx2, d2hldx3, d2hldy_, d2hldz1