Lineage for d1clva2 (1clv A:1-378)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829818Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2829819Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins)
    members of the family may contain various insert subdomains
    in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain
  6. 2829862Protein Animal alpha-amylase [51458] (3 species)
    contains Ca2+-binding subdomain, residues 100-170
  7. 2829939Species Yellow mealworm (Tenebrio molitor), larva [TaxId:7067] [51461] (4 PDB entries)
  8. 2829941Domain d1clva2: 1clv A:1-378 [28761]
    Other proteins in same PDB: d1clva1, d1clvi_
    complexed with ca, cl
    has additional subdomain(s) that are not in the common domain

Details for d1clva2

PDB Entry: 1clv (more details), 2 Å

PDB Description: yellow meal worm alpha-amylase in complex with the amaranth alpha- amylase inhibitor
PDB Compounds: (A:) protein (alpha-amylase)

SCOPe Domain Sequences for d1clva2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1clva2 c.1.8.1 (A:1-378) Animal alpha-amylase {Yellow mealworm (Tenebrio molitor), larva [TaxId: 7067]}
ekdanfasgrnsivhlfewkwndiadecerflqpqgfggvqisppneylvadgrpwwery
qpvsyiintrsgdesaftdmtrrcndagvriyvdavinhmtgmngvgtsgssadhdgmny
pavpygsgdfhspcevnnyqdadnvrncelvglrdlnqgsdyvrgvlidymnhmidlgva
gfrvdaakhmspgdlsvifsglknlntdygfadgarpfiyqevidlggeaiskneytgfg
cvlefqfgvslgnafqggnqlknlanwgpewgllegldavvfvdnhdnqrtggsqiltyk
npkpykmaiafmlahpygttrimssfdftdndqgppqdgsgnlispginddntcsngyvc
ehrwrqvygmvgfrnave

SCOPe Domain Coordinates for d1clva2:

Click to download the PDB-style file with coordinates for d1clva2.
(The format of our PDB-style files is described here.)

Timeline for d1clva2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1clva1
View in 3D
Domains from other chains:
(mouse over for more information)
d1clvi_