Lineage for d1bvnp2 (1bvn P:1-403)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 64292Fold c.1: TIM beta/alpha-barrel [51350] (24 superfamilies)
  4. 64720Superfamily c.1.8: (Trans)glycosidases [51445] (8 families) (S)
  5. 64721Family c.1.8.1: alpha-Amylases, N-terminal domain [51446] (12 proteins)
  6. 64726Protein Animal alpha-amylase [51458] (3 species)
  7. 64738Species Pig (Sus scrofa) [TaxId:9823] [51459] (8 PDB entries)
  8. 64746Domain d1bvnp2: 1bvn P:1-403 [28754]
    Other proteins in same PDB: d1bvnp1, d1bvnt_

Details for d1bvnp2

PDB Entry: 1bvn (more details), 2.5 Å

PDB Description: pig pancreatic alpha-amylase in complex with the proteinaceous inhibitor tendamistat

SCOP Domain Sequences for d1bvnp2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bvnp2 c.1.8.1 (P:1-403) Animal alpha-amylase {Pig (Sus scrofa)}
qyapqtqsgrtdivhlfewrwvdialecerylgpkgfggvqvsppnenvvvtnpsrpwwe
ryqpvsyklctrsgnenefrdmvtrcnnvgvriyvdavinhmcgsgaaagtgttcgsycn
pgsrefpavpysawdfndgkcktasggiesyndpyqvrdcqlvglldlalekdyvrsmia
dylnklidigvagfrldaskhmwpgdikavldklhnlntnwfpagsrpfifqevidlgge
aissseyfgngrvtefkygaklgtvvrkwsgekmsylknwgegwgfmpsdralvfvdnhd
nqrghgaggssiltfwdarlykvavgfmlahpygftrvmssyrwarnfvngedvndwigp
pnnngvikevtinadttcgndwvcehrwreirnmvwfrnvvdg

SCOP Domain Coordinates for d1bvnp2:

Click to download the PDB-style file with coordinates for d1bvnp2.
(The format of our PDB-style files is described here.)

Timeline for d1bvnp2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1bvnp1
View in 3D
Domains from other chains:
(mouse over for more information)
d1bvnt_