Class c: Alpha and beta proteins (a/b) [51349] (134 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (32 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (13 families) |
Family c.1.8.1: Amylase, catalytic domain [51446] (24 proteins) members of the family may contain various insert subdomains in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain |
Protein Animal alpha-amylase [51458] (3 species) contains Ca2+-binding subdomain, residues 100-170 |
Species Pig (Sus scrofa) [TaxId:9823] [51459] (12 PDB entries) |
Domain d1pif_2: 1pif 1-403 [28752] Other proteins in same PDB: d1pif_1 complexed with ca, cl |
PDB Entry: 1pif (more details), 2.3 Å
SCOP Domain Sequences for d1pif_2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pif_2 c.1.8.1 (1-403) Animal alpha-amylase {Pig (Sus scrofa)} eyapqtqsgrtsivhlfewrwvdialecerylgpkgfggvqvsppnenvvvtnpsrpwwe ryqpvsyklctrsgnenefrdmvtrcnnvgvriyvdavinhmcgsgaaagtgttcgsycn pgsrefpavpysawdfndgkcktasggiesyndpyqvrdcqlvglldlalekdyvrsmia dylnklidigvagfridaskhmwpgdikavldklhnlntnwfpagsrpfifqevidlgge aissseyfgngrvtefkygaklgtvvrkwsgekmsylknwgegwgfmpsdralvfvdnhd nqrghgaggssiltfwdarlykvavgfmlahpygftrvmssyrwarnfvngedvndwigp pnnngvikevtinadttcgndwvcehrwreirnmvwfrnvvdg
Timeline for d1pif_2: