Lineage for d1pif_2 (1pif 1-403)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 115904Fold c.1: TIM beta/alpha-barrel [51350] (24 superfamilies)
  4. 116348Superfamily c.1.8: (Trans)glycosidases [51445] (9 families) (S)
  5. 116349Family c.1.8.1: alpha-Amylases, N-terminal domain [51446] (13 proteins)
  6. 116359Protein Animal alpha-amylase [51458] (3 species)
  7. 116374Species Pig (Sus scrofa) [TaxId:9823] [51459] (8 PDB entries)
  8. 116380Domain d1pif_2: 1pif 1-403 [28752]
    Other proteins in same PDB: d1pif_1

Details for d1pif_2

PDB Entry: 1pif (more details), 2.3 Å

PDB Description: pig alpha-amylase

SCOP Domain Sequences for d1pif_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pif_2 c.1.8.1 (1-403) Animal alpha-amylase {Pig (Sus scrofa)}
eyapqtqsgrtsivhlfewrwvdialecerylgpkgfggvqvsppnenvvvtnpsrpwwe
ryqpvsyklctrsgnenefrdmvtrcnnvgvriyvdavinhmcgsgaaagtgttcgsycn
pgsrefpavpysawdfndgkcktasggiesyndpyqvrdcqlvglldlalekdyvrsmia
dylnklidigvagfridaskhmwpgdikavldklhnlntnwfpagsrpfifqevidlgge
aissseyfgngrvtefkygaklgtvvrkwsgekmsylknwgegwgfmpsdralvfvdnhd
nqrghgaggssiltfwdarlykvavgfmlahpygftrvmssyrwarnfvngedvndwigp
pnnngvikevtinadttcgndwvcehrwreirnmvwfrnvvdg

SCOP Domain Coordinates for d1pif_2:

Click to download the PDB-style file with coordinates for d1pif_2.
(The format of our PDB-style files is described here.)

Timeline for d1pif_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1pif_1