Lineage for d1pig_2 (1pig 1-403)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 18353Fold c.1: TIM beta/alpha-barrel [51350] (23 superfamilies)
  4. 18710Superfamily c.1.8: (Trans)glycosidases [51445] (7 families) (S)
  5. 18711Family c.1.8.1: alpha-Amylases, N-terminal domain [51446] (11 proteins)
  6. 18715Protein Animal alpha-amylase [51458] (3 species)
  7. 18722Species Pig (Sus scrofa) [TaxId:9823] [51459] (7 PDB entries)
  8. 18726Domain d1pig_2: 1pig 1-403 [28751]
    Other proteins in same PDB: d1pig_1

Details for d1pig_2

PDB Entry: 1pig (more details), 2.2 Å

PDB Description: pig pancreatic alpha-amylase complexed with the oligosaccharide v-1532

SCOP Domain Sequences for d1pig_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pig_2 c.1.8.1 (1-403) Animal alpha-amylase {Pig (Sus scrofa)}
eyapqtqsgrtsivhlfewrwvdialecerylgpkgfggvqvsppnenvvvtnpsrpwwe
ryqpvsyklctrsgnenefrdmvtrcnnvgvriyvdavinhmcgsgaaagtgttcgsycn
pgsrefpavpysawdfndgkcktasggiesyndpyqvrdcqlvglldlalekdyvrsmia
dylnklidigvagfridaskhmwpgdikavldklhnlntnwfpagsrpfifqevidlgge
aissseyfgngrvtefkygaklgtvvrkwsgekmsylknwgegwgfmpsdralvfvdnhd
nqrghgaggssiltfwdarlykvavgfmlahpygftrvmssyrwarnfvngedvndwigp
pnnngvikevtinadttcgndwvcehrwreirnmvwfrnvvdg

SCOP Domain Coordinates for d1pig_2:

Click to download the PDB-style file with coordinates for d1pig_2.
(The format of our PDB-style files is described here.)

Timeline for d1pig_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1pig_1