Lineage for d1ciua4 (1ciu A:1-406)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 968086Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 969862Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 969863Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins)
    members of the family may contain various insert subdomains
    in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain
  6. 970086Protein Cyclodextrin glycosyltransferase [51452] (6 species)
    contains two more all-beta domains, one is Immunoglobulin-like and the other is trasthyretin-like
  7. 970150Species Thermoanaerobacterium thermosulfurigenes, EM1 [TaxId:33950] [51457] (2 PDB entries)
  8. 970151Domain d1ciua4: 1ciu A:1-406 [28746]
    Other proteins in same PDB: d1ciua1, d1ciua2, d1ciua3
    complexed with ca

Details for d1ciua4

PDB Entry: 1ciu (more details), 2.3 Å

PDB Description: thermostable cgtase from thermoanaerobacterium thermosulfurigenes em1 at ph 8.0.
PDB Compounds: (A:) cyclodextrin glycosyltransferase

SCOPe Domain Sequences for d1ciua4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ciua4 c.1.8.1 (A:1-406) Cyclodextrin glycosyltransferase {Thermoanaerobacterium thermosulfurigenes, EM1 [TaxId: 33950]}
asdtavsnvvnystdviyqivtdrfvdgntsnnptgdlydpthtslkkyfggdwqgiink
indgyltgmgvtaiwisqpveniyavlpdstfggstsyhgywardfkrtnpyfgsftdfq
nlintahahnikviidfapnhtspasetdptyaengrlydngtllggytndtngyfhhyg
gtdfssyedgiyrnlfdladlnqqnstidsylksaikvwldmgidgirldavkhmpfgwq
knfmdsilsyrpvftfgewflgtneidvnntyfanesgmslldfrfsqkvrqvfrdntdt
mygldsmiqstasdynfindmvtfidnhdmdrfynggstrpveqalaftltsrgvpaiyy
gteqymtgngdpynrammtsfntsttaynvikklaplrksnpaiay

SCOPe Domain Coordinates for d1ciua4:

Click to download the PDB-style file with coordinates for d1ciua4.
(The format of our PDB-style files is described here.)

Timeline for d1ciua4: