SCOPe 2.01: Domain d1ciua4: 1ciu A:1-406

Lineage for d1ciua4 (1ciu A:1-406)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins)
   members of the family may contain various insert subdomains
   in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain

6. Protein Cyclodextrin glycosyltransferase [51452] (6 species)
   contains two more all-beta domains, one is Immunoglobulin-like and the other is trasthyretin-like

7. Species Thermoanaerobacterium thermosulfurigenes, EM1 [TaxId:33950] [51457] (2 PDB entries)

8. Domain d1ciua4: 1ciu A:1-406 [28746]
   Other proteins in same PDB: d1ciua1, d1ciua2, d1ciua3
   complexed with ca

Details for d1ciua4

PDB Entry: 1ciu, 2.3 Å

PDB Description: thermostable cgtase from thermoanaerobacterium thermosulfurigenes em1 at ph 8.0.

PDB Compounds: (A:) cyclodextrin glycosyltransferase

SCOPe Domain Sequences for d1ciua4:

Sequence; same for both SEQRES and ATOM records:

>d1ciua4 c.1.8.1 (A:1-406) Cyclodextrin glycosyltransferase {Thermoanaerobacterium thermosulfurigenes, EM1 [TaxId: 33950]}
asdtavsnvvnystdviyqivtdrfvdgntsnnptgdlydpthtslkkyfggdwqgiink
indgyltgmgvtaiwisqpveniyavlpdstfggstsyhgywardfkrtnpyfgsftdfq
nlintahahnikviidfapnhtspasetdptyaengrlydngtllggytndtngyfhhyg
gtdfssyedgiyrnlfdladlnqqnstidsylksaikvwldmgidgirldavkhmpfgwq
knfmdsilsyrpvftfgewflgtneidvnntyfanesgmslldfrfsqkvrqvfrdntdt
mygldsmiqstasdynfindmvtfidnhdmdrfynggstrpveqalaftltsrgvpaiyy
gteqymtgngdpynrammtsfntsttaynvikklaplrksnpaiay

Timeline for d1ciua4:

• d1ciua4 first appeared (with stable ids) in SCOP 1.55, called d1ciu_4
  
• d1ciua4 appears in SCOP 1.75
  
• d1ciua4 appears in SCOPe 2.02
  
• d1ciua4 appears in the current release, SCOPe 2.08