Lineage for d1dedb4 (1ded B:1-406)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 64292Fold c.1: TIM beta/alpha-barrel [51350] (24 superfamilies)
  4. 64720Superfamily c.1.8: (Trans)glycosidases [51445] (8 families) (S)
  5. 64721Family c.1.8.1: alpha-Amylases, N-terminal domain [51446] (12 proteins)
  6. 64770Protein Cyclodextrin glycosyltransferase [51452] (5 species)
  7. 64771Species Alkalophilic bacillus sp., strain 1011 [51456] (4 PDB entries)
  8. 64779Domain d1dedb4: 1ded B:1-406 [28745]
    Other proteins in same PDB: d1deda1, d1deda2, d1deda3, d1dedb1, d1dedb2, d1dedb3

Details for d1dedb4

PDB Entry: 1ded (more details), 2 Å

PDB Description: crystal structure of alkalophilic asparagine 233-replaced cyclodextrin glucanotransferase complexed with an inhibitor, acarbose, at 2.0 a resolution

SCOP Domain Sequences for d1dedb4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dedb4 c.1.8.1 (B:1-406) Cyclodextrin glycosyltransferase {Alkalophilic bacillus sp., strain 1011}
apdtsvsnkqnfstdviyqiftdrfsdgnpannptgaafdgsctnlrlycggdwqgiink
indgyltgmgitaiwisqpveniysvinysgvnntayhgywardfkktnpaygtmqdfkn
lidtahahnikviidfapnhtspassddpsfaengrlydngnllggytndtqnlfhhygg
tdfstiengiyknlydladlnhnnssvdvylkdaikmwldlgvdgirvdavknmpfgwqk
sfmatinnykpvftfgewflgvneispeyhqfanesgmslldfrfaqkarqvfrdntdnm
yglkamlegsevdyaqvndqvtfidnhdmerfhtsngdrrkleqalaftltsrgvpaiyy
gseqymsggndpdnrarlpsfsttttayqviqklaplrksnpaiay

SCOP Domain Coordinates for d1dedb4:

Click to download the PDB-style file with coordinates for d1dedb4.
(The format of our PDB-style files is described here.)

Timeline for d1dedb4: