Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) |
Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins) members of the family may contain various insert subdomains in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain |
Protein Cyclodextrin glycosyltransferase [51452] (5 species) contains two more all-beta domains, one is Immunoglobulin-like and the other is trasthyretin-like |
Species Bacillus sp. 1011, alkaliphilic [TaxId:1410] [51456] (8 PDB entries) Uniprot P05618 |
Domain d1pamb4: 1pam B:1-406 [28741] Other proteins in same PDB: d1pama1, d1pama2, d1pama3, d1pamb1, d1pamb2, d1pamb3 complexed with ca |
PDB Entry: 1pam (more details), 1.8 Å
SCOPe Domain Sequences for d1pamb4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pamb4 c.1.8.1 (B:1-406) Cyclodextrin glycosyltransferase {Bacillus sp. 1011, alkaliphilic [TaxId: 1410]} apdtsvsnkqnfstdviyqiftdrfsdgnpannptgaafdgsctnlrlycggdwqgiink indgyltgmgitaiwisqpveniysvinysgvnntayhgywardfkktnpaygtmqdfkn lidtahahnikviidfapnhtspassddpsfaengrlydngnllggytndtqnlfhhygg tdfstiengiyknlydladlnhnnssvdvylkdaikmwldlgvdgirvdavkhmpfgwqk sfmatinnykpvftfgewflgvneispeyhqfanesgmslldfrfaqkarqvfrdntdnm yglkamlegsevdyaqvndqvtfidnhdmerfhtsngdrrkleqalaftltsrgvpaiyy gseqymsggndpdnrarlpsfsttttayqviqklaplrksnpaiay
Timeline for d1pamb4:
View in 3D Domains from other chains: (mouse over for more information) d1pama1, d1pama2, d1pama3, d1pama4 |