SCOPe 2.07: Domain d1pama4: 1pam A:1-406

Lineage for d1pama4 (1pam A:1-406)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins)
   members of the family may contain various insert subdomains
   in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain

6. Protein Cyclodextrin glycosyltransferase [51452] (5 species)
   contains two more all-beta domains, one is Immunoglobulin-like and the other is trasthyretin-like

7. Species Bacillus sp. 1011, alkaliphilic [TaxId:1410] [51456] (8 PDB entries)
   Uniprot P05618

8. Domain d1pama4: 1pam A:1-406 [28740]
   Other proteins in same PDB: d1pama1, d1pama2, d1pama3, d1pamb1, d1pamb2, d1pamb3
   complexed with ca

Details for d1pama4

PDB Entry: 1pam, 1.8 Å

PDB Description: cyclodextrin glucanotransferase

PDB Compounds: (A:) cyclodextrin glucanotransferase

SCOPe Domain Sequences for d1pama4:

Sequence; same for both SEQRES and ATOM records:

>d1pama4 c.1.8.1 (A:1-406) Cyclodextrin glycosyltransferase {Bacillus sp. 1011, alkaliphilic [TaxId: 1410]}
apdtsvsnkqnfstdviyqiftdrfsdgnpannptgaafdgsctnlrlycggdwqgiink
indgyltgmgitaiwisqpveniysvinysgvnntayhgywardfkktnpaygtmqdfkn
lidtahahnikviidfapnhtspassddpsfaengrlydngnllggytndtqnlfhhygg
tdfstiengiyknlydladlnhnnssvdvylkdaikmwldlgvdgirvdavkhmpfgwqk
sfmatinnykpvftfgewflgvneispeyhqfanesgmslldfrfaqkarqvfrdntdnm
yglkamlegsevdyaqvndqvtfidnhdmerfhtsngdrrkleqalaftltsrgvpaiyy
gseqymsggndpdnrarlpsfsttttayqviqklaplrksnpaiay

Timeline for d1pama4:

• d1pama4 first appeared (with stable ids) in SCOP 1.55
  
• d1pama4 appears in SCOPe 2.06
  
• d1pama4 appears in the current release, SCOPe 2.08