SCOP 1.75: Domain d1qhpa4: 1qhp A:1-407

Lineage for d1qhpa4 (1qhp A:1-407)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (14 families)

5. Family c.1.8.1: Amylase, catalytic domain [51446] (25 proteins)
   members of the family may contain various insert subdomains
   in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain

6. Protein Cyclodextrin glycosyltransferase [51452] (6 species)
   contains two more all-beta domains, one is Immunoglobulin-like and the other is trasthyretin-like

7. Species Bacillus stearothermophilus, maltogenic alpha-amylase [TaxId:1422] [51455] (2 PDB entries)

8. Domain d1qhpa4: 1qhp A:1-407 [28739]
   Other proteins in same PDB: d1qhpa1, d1qhpa2, d1qhpa3
   complexed with ca, mal, so4

Details for d1qhpa4

PDB Entry: 1qhp, 1.7 Å

PDB Description: five-domain alpha-amylase from bacillus stearothermophilus, maltose complex

PDB Compounds: (A:) alpha-amylase

SCOP Domain Sequences for d1qhpa4:

Sequence; same for both SEQRES and ATOM records:

>d1qhpa4 c.1.8.1 (A:1-407) Cyclodextrin glycosyltransferase {Bacillus stearothermophilus, maltogenic alpha-amylase [TaxId: 1422]}
sssasvkgdviyqiiidrfydgdttnnnpaksyglydptkskwkmywggdlegvrqklpy
lkqlgvttiwlspvldnldtlagtdntgyhgywtrdfkqieehfgnwttfdtlvndahqn
gikvivdfvpnhstpfkandstfaeggalynngtymgnyfddatkgyfhhngdisnwddr
yeaqwknftdpagfsladlsqengtiaqyltdaavqlvahgadglridavkhfnsgfsks
ladklyqkkdiflvgewygddpgtanhlekvryannsgvnvldfdlntvirnvfgtftqt
mydlnnmvnqtgneykykenlitfidnhdmsrflsvnsnkanlhqalafiltsrgtpsiy
ygteqymaggndpynrgmmpafdttttafkevstlaglrrnnaaiqy

Timeline for d1qhpa4:

• d1qhpa4 first appeared (with stable ids) in SCOP 1.55
  
• d1qhpa4 appears in SCOP 1.73
  
• d1qhpa4 appears in SCOPe 2.01
  
• d1qhpa4 appears in the current release, SCOPe 2.08