Lineage for d1qhoa4 (1qho A:1-407)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2438500Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2438501Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins)
    members of the family may contain various insert subdomains
    in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain
  6. 2438739Protein Cyclodextrin glycosyltransferase [51452] (5 species)
    contains two more all-beta domains, one is Immunoglobulin-like and the other is trasthyretin-like
  7. 2438800Species Bacillus stearothermophilus, maltogenic alpha-amylase [TaxId:1422] [51455] (2 PDB entries)
  8. 2438801Domain d1qhoa4: 1qho A:1-407 [28738]
    Other proteins in same PDB: d1qhoa1, d1qhoa2, d1qhoa3
    complexed with abd, ca, mal, so4

Details for d1qhoa4

PDB Entry: 1qho (more details), 1.7 Å

PDB Description: five-domain alpha-amylase from bacillus stearothermophilus, maltose/acarbose complex
PDB Compounds: (A:) alpha-amylase

SCOPe Domain Sequences for d1qhoa4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qhoa4 c.1.8.1 (A:1-407) Cyclodextrin glycosyltransferase {Bacillus stearothermophilus, maltogenic alpha-amylase [TaxId: 1422]}
sssasvkgdviyqiiidrfydgdttnnnpaksyglydptkskwkmywggdlegvrqklpy
lkqlgvttiwlspvldnldtlagtdntgyhgywtrdfkqieehfgnwttfdtlvndahqn
gikvivdfvpnhstpfkandstfaeggalynngtymgnyfddatkgyfhhngdisnwddr
yeaqwknftdpagfsladlsqengtiaqyltdaavqlvahgadglridavkhfnsgfsks
ladklyqkkdiflvgewygddpgtanhlekvryannsgvnvldfdlntvirnvfgtftqt
mydlnnmvnqtgneykykenlitfidnhdmsrflsvnsnkanlhqalafiltsrgtpsiy
ygteqymaggndpynrgmmpafdttttafkevstlaglrrnnaaiqy

SCOPe Domain Coordinates for d1qhoa4:

Click to download the PDB-style file with coordinates for d1qhoa4.
(The format of our PDB-style files is described here.)

Timeline for d1qhoa4: