Lineage for d1qhoa4 (1qho A:1-407)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 64292Fold c.1: TIM beta/alpha-barrel [51350] (24 superfamilies)
  4. 64720Superfamily c.1.8: (Trans)glycosidases [51445] (8 families) (S)
  5. 64721Family c.1.8.1: alpha-Amylases, N-terminal domain [51446] (12 proteins)
  6. 64770Protein Cyclodextrin glycosyltransferase [51452] (5 species)
  7. 64811Species Bacillus stearothermophilus, maltogenic alpha-amylase [TaxId:1422] [51455] (2 PDB entries)
  8. 64812Domain d1qhoa4: 1qho A:1-407 [28738]
    Other proteins in same PDB: d1qhoa1, d1qhoa2, d1qhoa3

Details for d1qhoa4

PDB Entry: 1qho (more details), 1.7 Å

PDB Description: five-domain alpha-amylase from bacillus stearothermophilus, maltose/acarbose complex

SCOP Domain Sequences for d1qhoa4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qhoa4 c.1.8.1 (A:1-407) Cyclodextrin glycosyltransferase {Bacillus stearothermophilus, maltogenic alpha-amylase}
sssasvkgdviyqiiidrfydgdttnnnpaksyglydptkskwkmywggdlegvrqklpy
lkqlgvttiwlspvldnldtlagtdntgyhgywtrdfkqieehfgnwttfdtlvndahqn
gikvivdfvpnhstpfkandstfaeggalynngtymgnyfddatkgyfhhngdisnwddr
yeaqwknftdpagfsladlsqengtiaqyltdaavqlvahgadglridavkhfnsgfsks
ladklyqkkdiflvgewygddpgtanhlekvryannsgvnvldfdlntvirnvfgtftqt
mydlnnmvnqtgneykykenlitfidnhdmsrflsvnsnkanlhqalafiltsrgtpsiy
ygteqymaggndpynrgmmpafdttttafkevstlaglrrnnaaiqy

SCOP Domain Coordinates for d1qhoa4:

Click to download the PDB-style file with coordinates for d1qhoa4.
(The format of our PDB-style files is described here.)

Timeline for d1qhoa4: