Lineage for d1dtua4 (1dtu A:1-406)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1336838Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1339265Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 1339266Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins)
    members of the family may contain various insert subdomains
    in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain
  6. 1339500Protein Cyclodextrin glycosyltransferase [51452] (5 species)
    contains two more all-beta domains, one is Immunoglobulin-like and the other is trasthyretin-like
  7. 1339501Species Bacillus circulans, different strains [TaxId:1397] [51453] (36 PDB entries)
  8. 1339537Domain d1dtua4: 1dtu A:1-406 [28734]
    Other proteins in same PDB: d1dtua1, d1dtua2, d1dtua3
    complexed with adh, ca; mutant

Details for d1dtua4

PDB Entry: 1dtu (more details), 2.4 Å

PDB Description: bacillus circulans strain 251 cyclodextrin glycosyltransferase: a mutant y89d/s146p complexed to an hexasaccharide inhibitor
PDB Compounds: (A:) protein (cyclodextrin glycosyltransferase)

SCOPe Domain Sequences for d1dtua4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dtua4 c.1.8.1 (A:1-406) Cyclodextrin glycosyltransferase {Bacillus circulans, different strains [TaxId: 1397]}
apdtsvsnkqnfstdviyqiftdrfsdgnpannptgaafdgtctnlrlycggdwqgiink
indgyltgmgvtaiwisqpveniysiindsgvnntayhgywardfkktnpaygtiadfqn
liaaahaknikviidfapnhtspaspdqpsfaengrlydngtllggytndtqnlfhhngg
tdfsttengiyknlydladlnhnnstvdvylkdaikmwldlgidgirmdavkhmpfgwqk
sfmaavnnykpvftfgewflgvnevspenhkfanesgmslldfrfaqkvrqvfrdntdnm
yglkamlegsaadyaqvddqvtfidnhdmerfhasnanrrkleqalaftltsrgvpaiyy
gteqymsggtdpdnraripsfststtayqviqklaplrkcnpaiay

SCOPe Domain Coordinates for d1dtua4:

Click to download the PDB-style file with coordinates for d1dtua4.
(The format of our PDB-style files is described here.)

Timeline for d1dtua4: