Lineage for d2dija4 (2dij A:1-406)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829818Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2829819Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins)
    members of the family may contain various insert subdomains
    in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain
  6. 2830058Protein Cyclodextrin glycosyltransferase [51452] (5 species)
    contains two more all-beta domains, one is Immunoglobulin-like and the other is trasthyretin-like
  7. 2830059Species Bacillus circulans, different strains [TaxId:1397] [51453] (36 PDB entries)
  8. 2830098Domain d2dija4: 2dij A:1-406 [28730]
    Other proteins in same PDB: d2dija1, d2dija2, d2dija3
    complexed with adh, ca; mutant
    has additional subdomain(s) that are not in the common domain

Details for d2dija4

PDB Entry: 2dij (more details), 2.6 Å

PDB Description: complex of a y195f mutant cgtase from b. circulans strain 251 complexed with a maltononaose inhibitor at ph 9.8 obtained after soaking the crystal with acarbose and maltohexaose
PDB Compounds: (A:) cyclodextrin glycosyltransferase

SCOPe Domain Sequences for d2dija4:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dija4 c.1.8.1 (A:1-406) Cyclodextrin glycosyltransferase {Bacillus circulans, different strains [TaxId: 1397]}
apdtsvsnkqnfstdviyqiftdrfsdgnpannptgaafdgtctnlrlycggdwqgiink
indgyltgmgvtaiwisqpveniysiinysgvnntayhgywardfkktnpaygtiadfqn
liaaahaknikviidfapnhtspassdqpsfaengrlydngtllggytndtqnlfhhngg
tdfsttengiyknlfdladlnhnnstvdvylkdaikmwldlgidgirmdavkhmpfgwqk
sfmaavnnykpvftfgewflgvnevspenhkfanesgmslldfrfaqkvrqvfrdntdnm
yglkamlegsaadyaqvddqvtfidnhdmerfhasnanrrkleqalaftltsrgvpaiyy
gteqymsggtdpdnraripsfststtayqviqklaplrkcnpaiay

SCOPe Domain Coordinates for d2dija4:

Click to download the PDB-style file with coordinates for d2dija4.
(The format of our PDB-style files is described here.)

Timeline for d2dija4: