Lineage for d1tcmb4 (1tcm B:1-406)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 64292Fold c.1: TIM beta/alpha-barrel [51350] (24 superfamilies)
  4. 64720Superfamily c.1.8: (Trans)glycosidases [51445] (8 families) (S)
  5. 64721Family c.1.8.1: alpha-Amylases, N-terminal domain [51446] (12 proteins)
  6. 64770Protein Cyclodextrin glycosyltransferase [51452] (5 species)
  7. 64780Species Bacillus circulans, different strains [TaxId:1397] [51453] (27 PDB entries)
  8. 64798Domain d1tcmb4: 1tcm B:1-406 [28728]
    Other proteins in same PDB: d1tcma1, d1tcma2, d1tcma3, d1tcmb1, d1tcmb2, d1tcmb3

Details for d1tcmb4

PDB Entry: 1tcm (more details), 2.2 Å

PDB Description: cyclodextrin glycosyltransferase w616a mutant from bacillus circulans strain 251

SCOP Domain Sequences for d1tcmb4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tcmb4 c.1.8.1 (B:1-406) Cyclodextrin glycosyltransferase {Bacillus circulans, different strains}
apdtsvsnkqnfstdviyqiftdrfsdgnpannptgaafdgtctnlrlycggdwqgiink
indgyltgmgvtaiwisqpveniysiinysgvnntayhgywardfkktnpaygtiadfqn
liaaahaknikviidfapnhtspassdqpsfaengrlydngtllggytndtqnlfhhngg
tdfsttengiyknlydladlnhnnstvdvylkdaikmwldlgidgirmdavkhmpfgwqk
sfmaavnnykpvftfgewflgvnevspenhkfanesgmslldfrfaqkvrqvfrdntdnm
yglkamlegsaadyaqvddqvtfidnhdmerfhasnanrrkleqalaftltsrgvpaiyy
gteqymsggtdpdnraripsfststtayqviqklaplrkcnpaiay

SCOP Domain Coordinates for d1tcmb4:

Click to download the PDB-style file with coordinates for d1tcmb4.
(The format of our PDB-style files is described here.)

Timeline for d1tcmb4: