Lineage for d1cgx_4 (1cgx 1-406)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 570217Fold c.1: TIM beta/alpha-barrel [51350] (32 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 571086Superfamily c.1.8: (Trans)glycosidases [51445] (13 families) (S)
  5. 571087Family c.1.8.1: Amylase, catalytic domain [51446] (24 proteins)
    members of the family may contain various insert subdomains
    in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain
  6. 571271Protein Cyclodextrin glycosyltransferase [51452] (5 species)
    contains two more all-beta domains, one is Immunoglobulin-like and the other is trasthyretin-like
  7. 571289Species Bacillus circulans, different strains [TaxId:1397] [51453] (36 PDB entries)
  8. 571315Domain d1cgx_4: 1cgx 1-406 [28726]
    Other proteins in same PDB: d1cgx_1, d1cgx_2, d1cgx_3
    complexed with ca, mal; mutant

Details for d1cgx_4

PDB Entry: 1cgx (more details), 2.59 Å

PDB Description: site directed mutations of the active site residue tyrosine 195 of cyclodextrin glyxosyltransferase from bacillus circulans strain 251 affecting activity and product specificity

SCOP Domain Sequences for d1cgx_4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cgx_4 c.1.8.1 (1-406) Cyclodextrin glycosyltransferase {Bacillus circulans, different strains}
apdtsvsnkqnfstdviyqiftdrfsdgnpannptgaafdgtctnlrlycggdwqgiink
indgyltgmgvtaiwisqpveniysiinysgvnntayhgywardfkktnpaygtiadfqn
liaaahaknikviidfapnhtspassdqpsfaengrlydngtllggytndtqnlfhhngg
tdfsttengiyknlldladlnhnnstvdvylkdaikmwldlgidgirmdavkhmpfgwqk
sfmaavnnykpvftfgewflgvnevspenhkfanesgmslldfrfaqkvrqvfrdntdnm
yglkamlegsaadyaqvddqvtfidnhdmerfhasnanrrkleqalaftltsrgvpaiyy
gteqymsggtdpdnraripsfststtayqviqklaplrkcnpaiay

SCOP Domain Coordinates for d1cgx_4:

Click to download the PDB-style file with coordinates for d1cgx_4.
(The format of our PDB-style files is described here.)

Timeline for d1cgx_4: