Lineage for d8cgta4 (8cgt A:1-406)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 18353Fold c.1: TIM beta/alpha-barrel [51350] (23 superfamilies)
  4. 18710Superfamily c.1.8: (Trans)glycosidases [51445] (7 families) (S)
  5. 18711Family c.1.8.1: alpha-Amylases, N-terminal domain [51446] (11 proteins)
  6. 18748Protein Cyclodextrin glycosyltransferase [51452] (5 species)
  7. 18756Species Bacillus circulans, different strains [TaxId:1397] [51453] (27 PDB entries)
  8. 18765Domain d8cgta4: 8cgt A:1-406 [28725]
    Other proteins in same PDB: d8cgta1, d8cgta2, d8cgta3

Details for d8cgta4

PDB Entry: 8cgt (more details), 2.4 Å

PDB Description: structure of cyclodextrin glycosyltransferase complexed with a thio- maltohexaose

SCOP Domain Sequences for d8cgta4:

Sequence; same for both SEQRES and ATOM records: (download)

>d8cgta4 c.1.8.1 (A:1-406) Cyclodextrin glycosyltransferase {Bacillus circulans, different strains}
dpdtavtnkqsfstdviyqvftdrfldgnpsnnptgaaydatcsnlklycggdwqglink
indnyfsdlgvtalwisqpvenifatinysgvtntayhgywardfkktnpyfgtmadfqn
littahakgikividfapnhtspametdtsfaengrlydngtlvggytndtngyfhhngg
sdfsslengiyknlydladfnhnnatidkyfkdaiklwldmgvdgirvdavkhmplgwqk
swmssiyahkpvftfgawflgsaasdadntdfanksgmslldfrfnsavrnvfrdntsnm
yaldsminstatdynqvndqvtfidnhdmdrfktsavnnrrleqalaftltsrgvpaiyy
gteqyltgngdpdnrakmpsfsksttafnvisklaplrksnpaiay

SCOP Domain Coordinates for d8cgta4:

Click to download the PDB-style file with coordinates for d8cgta4.
(The format of our PDB-style files is described here.)

Timeline for d8cgta4: