Lineage for d9cgta4 (9cgt A:1-406)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 968086Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 969862Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 969863Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins)
    members of the family may contain various insert subdomains
    in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain
  6. 970086Protein Cyclodextrin glycosyltransferase [51452] (6 species)
    contains two more all-beta domains, one is Immunoglobulin-like and the other is trasthyretin-like
  7. 970087Species Bacillus circulans, different strains [TaxId:1397] [51453] (36 PDB entries)
  8. 970108Domain d9cgta4: 9cgt A:1-406 [28724]
    Other proteins in same PDB: d9cgta1, d9cgta2, d9cgta3
    complexed with ca, tm5

Details for d9cgta4

PDB Entry: 9cgt (more details), 2.5 Å

PDB Description: structure of cyclodextrin glycosyltransferase complexed with a thio- maltopentaose
PDB Compounds: (A:) protein (cyclodextrin-glycosyltransferase)

SCOPe Domain Sequences for d9cgta4:

Sequence; same for both SEQRES and ATOM records: (download)

>d9cgta4 c.1.8.1 (A:1-406) Cyclodextrin glycosyltransferase {Bacillus circulans, different strains [TaxId: 1397]}
dpdtavtnkqsfstdviyqvftdrfldgnpsnnptgaaydatcsnlklycggdwqglink
indnyfsdlgvtalwisqpvenifatinysgvtntayhgywardfkktnpyfgtmadfqn
littahakgikividfapnhtspametdtsfaengrlydngtlvggytndtngyfhhngg
sdfsslengiyknlydladfnhnnatidkyfkdaiklwldmgvdgirvdavkhmplgwqk
swmssiyahkpvftfgawflgsaasdadntdfanksgmslldfrfnsavrnvfrdntsnm
yaldsminstatdynqvndqvtfidnhdmdrfktsavnnrrleqalaftltsrgvpaiyy
gteqyltgngdpdnrakmpsfsksttafnvisklaplrksnpaiay

SCOPe Domain Coordinates for d9cgta4:

Click to download the PDB-style file with coordinates for d9cgta4.
(The format of our PDB-style files is described here.)

Timeline for d9cgta4: