Lineage for d1cxh_4 (1cxh 1-406)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 18353Fold c.1: TIM beta/alpha-barrel [51350] (23 superfamilies)
  4. 18710Superfamily c.1.8: (Trans)glycosidases [51445] (7 families) (S)
  5. 18711Family c.1.8.1: alpha-Amylases, N-terminal domain [51446] (11 proteins)
  6. 18748Protein Cyclodextrin glycosyltransferase [51452] (5 species)
  7. 18756Species Bacillus circulans, different strains [TaxId:1397] [51453] (27 PDB entries)
  8. 18771Domain d1cxh_4: 1cxh 1-406 [28715]
    Other proteins in same PDB: d1cxh_1, d1cxh_2, d1cxh_3

Details for d1cxh_4

PDB Entry: 1cxh (more details), 2.4 Å

PDB Description: complex of cgtase with maltotetraose at room temperature and ph 9.6 based on diffraction data of a crystal soaked with maltoheptaose

SCOP Domain Sequences for d1cxh_4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cxh_4 c.1.8.1 (1-406) Cyclodextrin glycosyltransferase {Bacillus circulans, different strains}
apdtsvsnkqnfstdviyqiftdrfsdgnpannptgaafdgtctnlrlycggdwqgiink
indgyltgmgvtaiwisqpveniysiinysgvnntayhgywardfkktnpaygtiadfqn
liaaahaknikviidfapnhtspassdqpsfaengrlydngtllggytndtqnlfhhngg
tdfsttengiyknlydladlnhnnstvdvylkdaikmwldlgidgirmdavkhmpfgwqk
sfmaavnnykpvftfgewflgvnevspenhkfanesgmslldfrfaqkvrqvfrdntdnm
yglkamlegsaadyaqvddqvtfidnhdmerfhasnanrrkleqalaftltsrgvpaiyy
gteqymsggtdpdnraripsfststtayqviqklaplrkcnpaiay

SCOP Domain Coordinates for d1cxh_4:

Click to download the PDB-style file with coordinates for d1cxh_4.
(The format of our PDB-style files is described here.)

Timeline for d1cxh_4: