Lineage for d1cxea4 (1cxe A:1-406)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 814174Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 815285Superfamily c.1.8: (Trans)glycosidases [51445] (14 families) (S)
  5. 815286Family c.1.8.1: Amylase, catalytic domain [51446] (25 proteins)
    members of the family may contain various insert subdomains
    in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain
  6. 815510Protein Cyclodextrin glycosyltransferase [51452] (6 species)
    contains two more all-beta domains, one is Immunoglobulin-like and the other is trasthyretin-like
  7. 815511Species Bacillus circulans, different strains [TaxId:1397] [51453] (36 PDB entries)
  8. 815526Domain d1cxea4: 1cxe A:1-406 [28711]
    Other proteins in same PDB: d1cxea1, d1cxea2, d1cxea3
    complexed with ca, glc, mal

Details for d1cxea4

PDB Entry: 1cxe (more details), 2.1 Å

PDB Description: complex of cgtase with maltotetraose at room temperature and ph 9.1 based on diffraction data of a crystal soaked with alpha-cyclodextrin
PDB Compounds: (A:) cyclodextrin glycosyltransferase

SCOP Domain Sequences for d1cxea4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cxea4 c.1.8.1 (A:1-406) Cyclodextrin glycosyltransferase {Bacillus circulans, different strains [TaxId: 1397]}
apdtsvsnkqnfstdviyqiftdrfsdgnpannptgaafdgtctnlrlycggdwqgiink
indgyltgmgvtaiwisqpveniysiinysgvnntayhgywardfkktnpaygtiadfqn
liaaahaknikviidfapnhtspassdqpsfaengrlydngtllggytndtqnlfhhngg
tdfsttengiyknlydladlnhnnstvdvylkdaikmwldlgidgirmdavkhmpfgwqk
sfmaavnnykpvftfgewflgvnevspenhkfanesgmslldfrfaqkvrqvfrdntdnm
yglkamlegsaadyaqvddqvtfidnhdmerfhasnanrrkleqalaftltsrgvpaiyy
gteqymsggtdpdnraripsfststtayqviqklaplrkcnpaiay

SCOP Domain Coordinates for d1cxea4:

Click to download the PDB-style file with coordinates for d1cxea4.
(The format of our PDB-style files is described here.)

Timeline for d1cxea4: