Lineage for d1bag_2 (1bag 1-347)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.1: TIM beta/alpha-barrel [51350] (23 superfamilies) Superfamily c.1.8: (Trans)glycosidases [51445] (7 families) 
Family c.1.8.1: alpha-Amylases, N-terminal domain [51446] (11 proteins) 
Protein Bacterial alpha-amylase [51447] (4 species) 
Species Bacillus subtilis [TaxId:1423] [51450] (1 PDB entry) 
Domain d1bag_2: 1bag 1-347 [28707]
Other proteins in same PDB: d1bag_1
Details for d1bag_2
PDB Entry: 1bag (more details), 2.5 Å
PDB Description: alpha-amylase from bacillus subtilis complexed with maltopentaose
SCOP Domain Sequences for d1bag_2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bag_2 c.1.8.1 (1-347) Bacterial alpha-amylase {Bacillus subtilis}
ltapsiksgtilhawnwsfntlkhnmkdihdagytaiqtspinqvkegnqgdksmsnwyw
lyqptsyqignrylgteqefkemcaaaeeygikvivdavinhttfdyaaisnevksipnw
thgntqiknwsdrwdvtqnsllglydwntqntqvqsylkrfleralndgadgfrfdaakh
ielpddgsygsqfwpnitntsaefqygqilqdsasrdaayanymdvtasnyghsirsalk
nrnlgvsnishyasdvsadklvtwveshdtyanddeestwmsdddirlgwaviasrsgst
plffsrpegggngvrfpgksqigdrgsalfedqaitavnrfhnvmag
SCOP Domain Coordinates for d1bag_2:
Click to download the PDB-style file with coordinates for d1bag_2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1bag_2:
- d1bag_2 appears in SCOP 1.57
- d1bag_2 appears in the current release, SCOPe 2.08, called d1baga2
View in 3D
