SCOPe 2.06: Domain d2foma1: 2fom A:49-95

Lineage for d2foma1 (2fom A:49-95)

1. Root: SCOPe 2.06

2. Class g: Small proteins [56992] (94 folds)

3. Fold g.96: Flavivirus non-structural protein NS2B-like [310561] (1 superfamily)

4. Superfamily g.96.1: Flavivirus non-structural protein NS2B-like [310588] (2 families)
   Pfam PF01002; see PubMed 16532006 for discussion of NS2B-NS3pro complex

5. Family g.96.1.1: Flavivirus non-structural protein NS2B-like [310635] (2 proteins)

6. Protein Flavivirus non-structural protein NS2B [310766] (2 species)

7. Species Dengue virus 2 [TaxId:11060] [311021] (1 PDB entry)

8. Domain d2foma1: 2fom A:49-95 [287067]
   Other proteins in same PDB: d2foma2, d2foma3, d2fomb1
   complexed with cl, gol

Details for d2foma1

PDB Entry: 2fom, 1.5 Å

PDB Description: dengue virus ns2b/ns3 protease

PDB Compounds: (A:) Polyprotein

SCOPe Domain Sequences for d2foma1:

Sequence, based on SEQRES records:

>d2foma1 g.96.1.1 (A:49-95) Flavivirus non-structural protein NS2B {Dengue virus 2 [TaxId: 11060]}
adleleraadvrweeqaeisgsspilsitisedgsmsikneeeeqtl

Sequence, based on observed residues (ATOM records):

>d2foma1 g.96.1.1 (A:49-95) Flavivirus non-structural protein NS2B {Dengue virus 2 [TaxId: 11060]}
adleleraadvrweeqaeisgsspilsisikneeeeqtl

Timeline for d2foma1:

• d2foma1 is new in SCOPe 2.06-stable
  
• d2foma1 appears in SCOPe 2.07
  
• d2foma1 appears in the current release, SCOPe 2.08