Class g: Small proteins [56992] (94 folds) |
Fold g.96: Flavivirus non-structural protein NS2B-like [310561] (1 superfamily) |
Superfamily g.96.1: Flavivirus non-structural protein NS2B-like [310588] (2 families) Pfam PF01002; see PubMed 16532006 for discussion of NS2B-NS3pro complex |
Family g.96.1.1: Flavivirus non-structural protein NS2B-like [310635] (2 proteins) |
Protein Flavivirus non-structural protein NS2B [310766] (2 species) |
Species Dengue virus 2 [TaxId:11060] [311021] (1 PDB entry) |
Domain d2foma1: 2fom A:49-95 [287067] Other proteins in same PDB: d2foma2, d2foma3, d2fomb1 complexed with cl, gol |
PDB Entry: 2fom (more details), 1.5 Å
SCOPe Domain Sequences for d2foma1:
Sequence, based on SEQRES records: (download)
>d2foma1 g.96.1.1 (A:49-95) Flavivirus non-structural protein NS2B {Dengue virus 2 [TaxId: 11060]} adleleraadvrweeqaeisgsspilsitisedgsmsikneeeeqtl
>d2foma1 g.96.1.1 (A:49-95) Flavivirus non-structural protein NS2B {Dengue virus 2 [TaxId: 11060]} adleleraadvrweeqaeisgsspilsisikneeeeqtl
Timeline for d2foma1: