SCOPe 2.08: Domain d1ah4a_: 1ah4 A:

Lineage for d1ah4a_ (1ah4 A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families)

5. Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (16 proteins)
   Common fold covers whole protein structure

6. Protein Aldose reductase (aldehyde reductase) [51436] (2 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [51438] (12 PDB entries)

8. Domain d1ah4a_: 1ah4 A: [28684]
   complexed with nap

Details for d1ah4a_

PDB Entry: 1ah4, 2 Å

PDB Description: pig aldose reductase, holo form

PDB Compounds: (A:) aldose reductase

SCOPe Domain Sequences for d1ah4a_:

Sequence; same for both SEQRES and ATOM records:

>d1ah4a_ c.1.7.1 (A:) Aldose reductase (aldehyde reductase) {Pig (Sus scrofa) [TaxId: 9823]}
ashlvlytgakmpilglgtwksppgkvteavkvaidlgyrhidcahvyqnenevglglqe
klqgqvvkredlfivsklwctdheknlvkgacqttlrdlkldyldlylihwptgfkpgkd
pfpldgdgnvvpdesdfvetweameelvdeglvkaigvsnfnhlqvekilnkpglkykpa
vnqievhpyltqeklieyckskgivvtaysplgspdrpwakpedpslledprikaiaaky
nkttaqvlirfpmqrnlivipksvtperiaenfqvfdfelspedmntllsynrnwrvcal
mscashkdypfheey

Timeline for d1ah4a_:

• d1ah4a_ first appeared (with stable ids) in SCOP 1.55, called d1ah4__
  
• d1ah4a_ appears in SCOPe 2.07