SCOP 1.75: Domain d1qu4d2: 1qu4 D:44-283

Lineage for d1qu4d2 (1qu4 D:44-283)

Root: SCOP 1.75
Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
the first seven superfamilies have similar phosphate-binding sites

Superfamily c.1.6: PLP-binding barrel [51419] (2 families)
circular permutation of the canonical fold: begins with an alpha helix and ends with a beta-strand
Family c.1.6.1: Alanine racemase-like, N-terminal domain [51420] (3 proteins)
Protein Eukaryotic ornithine decarboxylase [51423] (3 species)
Species Trypanosoma brucei [TaxId:5691] [51426] (5 PDB entries)
Uniprot P07805
Domain d1qu4d2: 1qu4 D:44-283 [28662]
Other proteins in same PDB: d1qu4a1, d1qu4b1, d1qu4c1, d1qu4d1

Details for d1qu4d2

PDB Entry: 1qu4 (more details), 2.9 Å

PDB Description: crystal structure of trypanosoma brucei ornithine decarboxylase

PDB Compounds: (D:) ornithine decarboxylase

SCOP Domain Sequences for d1qu4d2:

Sequence, based on SEQRES records: (download)

>d1qu4d2 c.1.6.1 (D:44-283) Eukaryotic ornithine decarboxylase {Trypanosoma brucei [TaxId: 5691]}
dlgdivrkhetwkkclprvtpfyavkcnddwrvlgtlaalgtgfdcasnteiqrvrgigv
ppekiiyanpckqishiryardsgvdvmtfdcvdelekvakthpkakmvlristddslar
crlsvkfgakvedcrfileqakklnidvtgvsfhvgsgstdastfaqaisdsrfvfdmgt
elgfnmhildigggfpgtrdaplkfeeiagvinnalekhfppdlkltivaepgryyvasa

Sequence, based on observed residues (ATOM records): (download)

>d1qu4d2 c.1.6.1 (D:44-283) Eukaryotic ornithine decarboxylase {Trypanosoma brucei [TaxId: 5691]}
dlgdivrkhetwkkclprvtpfyavkcnddwrvlgtlaalgtgfdcasnteiqrvrgigv
ppekiiyanpckqishiryardsgvdvmtfdcvdelekvakthpkakmvlristlsvkfg
akvedcrfileqakklnidvtgvsfhvgsgstdastfaqaisdsrfvfdmgtelgfnmhi
ldigggfpgtrdaplkfeeiagvinnalekhfppdlkltivaepgryyvasa

SCOP Domain Coordinates for d1qu4d2:

Click to download the PDB-style file with coordinates for d1qu4d2.
(The format of our PDB-style files is described here.)

Timeline for d1qu4d2: