Lineage for d1f3ta2 (1f3t A:44-283)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1815292Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1817501Superfamily c.1.6: PLP-binding barrel [51419] (2 families) (S)
    circular permutation of the canonical fold: begins with an alpha helix and ends with a beta-strand
  5. 1817502Family c.1.6.1: Alanine racemase-like, N-terminal domain [51420] (3 proteins)
  6. 1817545Protein Eukaryotic ornithine decarboxylase [51423] (3 species)
  7. 1817551Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [51426] (5 PDB entries)
    Uniprot P07805
  8. 1817556Domain d1f3ta2: 1f3t A:44-283 [28655]
    Other proteins in same PDB: d1f3ta1, d1f3tb1, d1f3tc1, d1f3td1
    complexed with plp, put

Details for d1f3ta2

PDB Entry: 1f3t (more details), 2 Å

PDB Description: crystal structure of trypanosoma brucei ornithine decarboxylase (odc) complexed with putrescine, odc's reaction product.
PDB Compounds: (A:) ornithine decarboxylase

SCOPe Domain Sequences for d1f3ta2:

Sequence, based on SEQRES records: (download)

>d1f3ta2 c.1.6.1 (A:44-283) Eukaryotic ornithine decarboxylase {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
dlgdivrkhetwkkclprvtpfyavkcnddwrvlgtlaalgtgfdcasnteiqrvrgigv
ppekiiyanpckqishiryardsgvdvmtfdcvdelekvakthpkakmvlristddslar
crlsvkfgakvedcrfileqakklnidvtgvsfhvgsgstdastfaqaisdsrfvfdmgt
elgfnmhildigggfpgtrdaplkfeeiagvinnalekhfppdlkltivaepgryyvasa

Sequence, based on observed residues (ATOM records): (download)

>d1f3ta2 c.1.6.1 (A:44-283) Eukaryotic ornithine decarboxylase {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
dlgdivrkhetwkkclprvtpfyavkcnddwrvlgtlaalgtgfdcasnteiqrvrgigv
ppekiiyanpckqishiryardsgvdvmtfdcvdelekvakthpkakmvlristvkfgak
vedcrfileqakklnidvtgvsfhvgsgstdastfaqaisdsrfvfdmgtelgfnmhild
igggfpgtrdaplkfeeiagvinnalekhfppdlkltivaepgryyvasa

SCOPe Domain Coordinates for d1f3ta2:

Click to download the PDB-style file with coordinates for d1f3ta2.
(The format of our PDB-style files is described here.)

Timeline for d1f3ta2: