SCOPe 2.02: Domain d2todd2: 2tod D:44-283

Lineage for d2todd2 (2tod D:44-283)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.6: PLP-binding barrel [51419] (2 families)
   circular permutation of the canonical fold: begins with an alpha helix and ends with a beta-strand

5. Family c.1.6.1: Alanine racemase-like, N-terminal domain [51420] (3 proteins)

6. Protein Eukaryotic ornithine decarboxylase [51423] (3 species)

7. Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [51426] (5 PDB entries)
   Uniprot P07805

8. Domain d2todd2: 2tod D:44-283 [28654]
   Other proteins in same PDB: d2toda1, d2todb1, d2todc1, d2todd1
   complexed with dmo, plp; mutant

Details for d2todd2

PDB Entry: 2tod, 2 Å

PDB Description: ornithine decarboxylase from trypanosoma brucei k69a mutant in complex with alpha-difluoromethylornithine

PDB Compounds: (D:) protein (ornithine decarboxylase)

SCOPe Domain Sequences for d2todd2:

Sequence, based on SEQRES records:

>d2todd2 c.1.6.1 (D:44-283) Eukaryotic ornithine decarboxylase {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
dlgdivrkhetwkkclprvtpfyavacnddwrvlgtlaalgtgfdcasnteiqrvrgigv
ppekiiyanpckqishiryardsgvdvmtfdcvdelekvakthpkakmvlristddslar
crlsvkfgakvedcrfileqakklnidvtgvsfhvgsgstdastfaqaisdsrfvfdmgt
elgfnmhildigggfpgtrdaplkfeeiagvinnalekhfppdlkltivaepgryyvasa

Sequence, based on observed residues (ATOM records):

>d2todd2 c.1.6.1 (D:44-283) Eukaryotic ornithine decarboxylase {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
dlgdivrkhetwkkclprvtpfyavacnddwrvlgtlaalgtgfdcasnteiqrvrgigv
ppekiiyanpckqishiryardsgvdvmtfdcvdelekvakthpkakmvlristlsvkfg
akvedcrfileqakklnidvtgvsfhvgsgstdastfaqaisdsrfvfdmgtelgfnmhi
ldigggfpgtrdaplkfeeiagvinnalekhfppdlkltivaepgryyvasa

Timeline for d2todd2:

• d2todd2 first appeared (with stable ids) in SCOP 1.55
  
• d2todd2 appears in SCOPe 2.01
  
• d2todd2 appears in SCOPe 2.03
  
• d2todd2 appears in the current release, SCOPe 2.08