Lineage for d7odca2 (7odc A:44-283)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1815292Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1817501Superfamily c.1.6: PLP-binding barrel [51419] (2 families) (S)
    circular permutation of the canonical fold: begins with an alpha helix and ends with a beta-strand
  5. 1817502Family c.1.6.1: Alanine racemase-like, N-terminal domain [51420] (3 proteins)
  6. 1817545Protein Eukaryotic ornithine decarboxylase [51423] (3 species)
  7. 1817549Species Mouse (Mus musculus) [TaxId:10090] [51425] (1 PDB entry)
  8. 1817550Domain d7odca2: 7odc A:44-283 [28650]
    Other proteins in same PDB: d7odca1
    complexed with plp

Details for d7odca2

PDB Entry: 7odc (more details), 1.6 Å

PDB Description: crystal structure ornithine decarboxylase from mouse, truncated 37 residues from the c-terminus, to 1.6 angstrom resolution
PDB Compounds: (A:) protein (ornithine decarboxylase)

SCOPe Domain Sequences for d7odca2:

Sequence, based on SEQRES records: (download)

>d7odca2 c.1.6.1 (A:44-283) Eukaryotic ornithine decarboxylase {Mouse (Mus musculus) [TaxId: 10090]}
dlgdilkkhlrwlkalprvtpfyavkcndsraivstlaaigtgfdcaskteiqlvqglgv
paerviyanpckqvsqikyaasngvqmmtfdseielmkvarahpkaklvlriatddskav
crlsvkfgatlktsrlllerakelnidvigvsfhvgsgctdpdtfvqavsdarcvfdmat
evgfsmhlldigggfpgsedtklkfeeitsvinpaldkyfpsdsgvriiaepgryyvasa

Sequence, based on observed residues (ATOM records): (download)

>d7odca2 c.1.6.1 (A:44-283) Eukaryotic ornithine decarboxylase {Mouse (Mus musculus) [TaxId: 10090]}
dlgdilkkhlrwlkalprvtpfyavkcndsraivstlaaigtgfdcaskteiqlvqglgv
paerviyanpckqvsqikyaasngvqmmtfdseielmkvarahpkaklvlriatkfgatl
ktsrlllerakelnidvigvsfhvgsgctdpdtfvqavsdarcvfdmatevgfsmhlldi
gggfpgsedtklkfeeitsvinpaldkyfpsdsgvriiaepgryyvasa

SCOPe Domain Coordinates for d7odca2:

Click to download the PDB-style file with coordinates for d7odca2.
(The format of our PDB-style files is described here.)

Timeline for d7odca2:

View in 3D
Domains from same chain:
(mouse over for more information)
d7odca1