![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.6: PLP-binding barrel [51419] (2 families) ![]() circular permutation of the canonical fold: begins with an alpha helix and ends with a beta-strand |
![]() | Family c.1.6.1: Alanine racemase-like, N-terminal domain [51420] (3 proteins) |
![]() | Protein Eukaryotic ornithine decarboxylase [51423] (3 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [51424] (1 PDB entry) |
![]() | Domain d1d7kb2: 1d7k B:44-283 [28649] Other proteins in same PDB: d1d7ka1, d1d7kb1 |
PDB Entry: 1d7k (more details), 2.1 Å
SCOPe Domain Sequences for d1d7kb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1d7kb2 c.1.6.1 (B:44-283) Eukaryotic ornithine decarboxylase {Human (Homo sapiens) [TaxId: 9606]} dlgdilkkhlrwlkalprvtpfyavkcndskaivktlaatgtgfdcaskteiqlvqslgv pperiiyanpckqvsqikyaanngvqmmtfdsevelmkvarahpkaklvlriatddskav crlsvkfgatlrtsrlllerakelnidvvgvsfhvgsgctdpetfvqaisdarcvfdmga evgfsmylldigggfpgsedvklkfeeitgvinpaldkyfpsdsgvriiaepgryyvasa
Timeline for d1d7kb2: