SCOPe 2.04: Domain d2sfpb2: 2sfp B:12-244

Lineage for d2sfpb2 (2sfp B:12-244)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.6: PLP-binding barrel [51419] (2 families)
   circular permutation of the canonical fold: begins with an alpha helix and ends with a beta-strand

5. Family c.1.6.1: Alanine racemase-like, N-terminal domain [51420] (3 proteins)

6. Protein Alanine racemase [51421] (3 species)

7. Species Bacillus stearothermophilus [TaxId:1422] [51422] (8 PDB entries)

8. Domain d2sfpb2: 2sfp B:12-244 [28647]
   Other proteins in same PDB: d2sfpa1, d2sfpb1
   complexed with plp, ppi

Details for d2sfpb2

PDB Entry: 2sfp, 1.9 Å

PDB Description: alanine racemase with bound propionate inhibitor

PDB Compounds: (B:) protein (alanine racemase)

SCOPe Domain Sequences for d2sfpb2:

Sequence; same for both SEQRES and ATOM records:

>d2sfpb2 c.1.6.1 (B:12-244) Alanine racemase {Bacillus stearothermophilus [TaxId: 1422]}
vdldaiydnvenlrrllpddthimavvkanayghgdvqvartaleagasrlavafldeal
alrekgieapilvlgasrpadaalaaqqrialtvfrsdwleeasalysgpfpihfhlkmd
tgmgrlgvkdeeetkrivalierhphfvleglythfatadevntdyfsyqytrflhmlew
lpsrpplvhcansaaslrfpdrtfnmvrfgiamyglapspgikpllpyplkea

Timeline for d2sfpb2:

• d2sfpb2 first appeared (with stable ids) in SCOP 1.55
  
• d2sfpb2 appears in SCOPe 2.03
  
• d2sfpb2 appears in SCOPe 2.05
  
• d2sfpb2 appears in the current release, SCOPe 2.08